CoraLite®594-conjugated MBNL1 Monoclonal antibody

• 

  IF Staining of A431 using CL594-66837

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using CoraLite®594 MBNL1 antibody (CL594-66837, Clone: 1H2C12 ) at dilution of 1:200.

MBNL1 Monoclonal Antibody for IF/ICC

Cat No. CL594-66837

Clone No.1H2C12

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat, pig

Applications

IF/ICC

Synonyms

DKFZp686P06174, EXP, EXP35, EXP40, EXP42, KIAA0428, MBNL, MBNL1, muscleblind like (Drosophila), Muscleblind like protein 1

---

Tested Applications

• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66837 targets MBNL1 in IF/ICC applications and shows reactivity with Human, mouse, rat, pig samples.

• Tested Reactivity: Human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7752

  Product name: Recombinant human MBNL1 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 1-343 aa of BC050535

  Sequence: MGRCSRENCKYLHPPPHLKTQLEINGRNNLIQQKNMAMLAQQMQLANAMMPGAPLQPVPMFSVAPSLATNASAAAFNPYLGPVSPSLVPAEILPTAPMLVTGNPGVPVPAAAAAAAQKLMRTDRLEVCREYQRGNCNRGENDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQAKIKAAQYQVNQAAAAQAAATAAAMTQSAVKSLKRPLEATFDLGIPQAVLPPLPKRPALEKTNGATAVFNTGIFQYQQALANMQLQQHTAFLPPGSILCMTPATSVVPMVHGATPATVSAATTSATSVPFAATATANQIPIISAEHLTSHKYVTQM

• Full Name: muscleblind-like (Drosophila)
• Calculated Molecular Weight: 42 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC050535
• Gene Symbol: MBNL1
• Gene ID (NCBI): 4154
• RRID: AB_2934746
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9NR56
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

MBNL1 (muscleblind-like 1) is one of the MBNL proteins containing 3 members (MBNL1-3) in vertebrates. And MBNL1 is widely expressed in adult tissues including brain, heart and skeletal muscle (PMID:25274774). As a highly conserved RNA-binding protein, MBNL1 regulates alternative splicing, alternative polyadenylation, mRNA stability and mRNA localization in the nucleus. The neurological diseases DM1 and DM2 (myotonic dystrophy type 1 and type2) are caused by expansion of repetitive sequences in non-coding regions in the DMPK gene because of the inappropriate patterns of alternative splicing owing to MBNL1(PMID:24354850). The antibody could recognize the common full-length protein in applications.