CoraLite®594-conjugated MBNL1 Monoclonal antibody

MBNL1 Monoclonal Antibody for IF/ICC
Cat No. CL594-66837
Clone No.1H2C12

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat, pig

Applications

IF/ICC

DKFZp686P06174, EXP, EXP35, EXP40, EXP42, KIAA0428, MBNL, MBNL1, muscleblind like (Drosophila), Muscleblind like protein 1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inA431 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66837 targets MBNL1 in IF/ICC applications and shows reactivity with Human, mouse, rat, pig samples.

Tested Reactivity Human, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7752

Product name: Recombinant human MBNL1 protein

Source: e coli.-derived, T-HIS

Tag: 6*His

Domain: 1-343 aa of BC050535

Sequence: MGRCSRENCKYLHPPPHLKTQLEINGRNNLIQQKNMAMLAQQMQLANAMMPGAPLQPVPMFSVAPSLATNASAAAFNPYLGPVSPSLVPAEILPTAPMLVTGNPGVPVPAAAAAAAQKLMRTDRLEVCREYQRGNCNRGENDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQAKIKAAQYQVNQAAAAQAAATAAAMTQSAVKSLKRPLEATFDLGIPQAVLPPLPKRPALEKTNGATAVFNTGIFQYQQALANMQLQQHTAFLPPGSILCMTPATSVVPMVHGATPATVSAATTSATSVPFAATATANQIPIISAEHLTSHKYVTQM

Predict reactive species
Full Name muscleblind-like (Drosophila)
Calculated Molecular Weight 42 kDa
Observed Molecular Weight 40 kDa
GenBank Accession NumberBC050535
Gene Symbol MBNL1
Gene ID (NCBI) 4154
RRIDAB_2934746
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
Excitation LaserYellow-Green Laser (561 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9NR56
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

MBNL1 (muscleblind-like 1) is one of the MBNL proteins containing 3 members (MBNL1-3) in vertebrates. And MBNL1 is widely expressed in adult tissues including brain, heart and skeletal muscle (PMID:25274774). As a highly conserved RNA-binding protein, MBNL1 regulates alternative splicing, alternative polyadenylation, mRNA stability and mRNA localization in the nucleus. The neurological diseases DM1 and DM2 (myotonic dystrophy type 1 and type2) are caused by expansion of repetitive sequences in non-coding regions in the DMPK gene because of the inappropriate patterns of alternative splicing owing to MBNL1(PMID:24354850). The antibody could recognize the common full-length protein in applications.

Protocols

Product Specific Protocols
IF protocol for CL594 MBNL1 antibody CL594-66837Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...