MCM2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MCM2 Polyclonal antibody, PBS Only (10513-1-PBS)

• 

  WB analysis using 10513-1-AP (same clone as 10513-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10513-1-AP (MCM2 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10513-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 10513-1-AP (same clone as 10513-1-PBS)

  WB result of MCM2 antibody (10513-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-MCM2 transfected HEK-293 cells. This data was developed using the same antibody clone with 10513-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 10513-1-AP (same clone as 10513-1-PBS)

  Various cells were subjected to SDS PAGE followed by western blot with 10513-1-AP (MCM2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10513-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HEK-293 using 10513-1-AP (same clone as 10513-1-PBS)

  IP result of anti-MCM2 (IP:10513-1-AP, 4ug; Detection:10513-1-AP 1:800) with HEK-293 cells lysate 2800ug. This data was developed using the same antibody clone with 10513-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 10513-1-AP (same clone as 10513-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 10513-1-AP (MCM2 antibody) at dilution of 1:2000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10513-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 10513-1-AP (same clone as 10513-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 10513-1-AP (MCM2 antibody) at dilution of 1:2000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10513-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical cancer using 10513-1-AP (same clone as 10513-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 10513-1-AP (MCM2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10513-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical cancer using 10513-1-AP (same clone as 10513-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 10513-1-AP (MCM2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10513-1-PBS in a different storage buffer formulation.

• 

  FC experiment of NIH/3T3 using 10513-1-AP (same clone as 10513-1-PBS)

  1X10^6 NIH/3T3 cells were intracellularly stained with 0.2 ug Anti-Human MCM2 (10513-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.2 ug Control Antibody. Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 10513-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 10513-1-AP (same clone as 10513-1-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug MCM2 Polyclonal antibody (10513-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 10513-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

MCM2 Polyclonal Antibody for WB, IHC, FC (Intra), IP, Indirect ELISA

Cat No. 10513-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, FC (Intra), IP, Indirect ELISA

Synonyms

BM28, CCNL1, CDCL1, EC:3.6.4.12, KIAA0030

---

Product Information

10513-1-PBS targets MCM2 in WB, IHC, FC (Intra), IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0798

  Product name: Recombinant human MCM2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 657-904 aa of BC007670

  Sequence: FDILCVVRDTVDPVQDEMLARFVVGSHVRHHPSNKEEEGLANGSAAEPAMPNTYGVEPLPQEVLKKYIIYAKERVHPKLNQMDQDKVAKMYSDLRKESMATGSIPITVRHIESMIRMAEAHARIHLRDYVIEDDVNMAIRVMLESFIDTQKFSVMRSMRKTFARYLSFRRDNNELLLFILKQLVAEQVTYQRNRFGAQQDTIEVPEKDLVDKARQINIHNLSAFYDSELFRMNKFSHDLKRKMILQQF

• Full Name: minichromosome maintenance complex component 2
• Calculated Molecular Weight: 102 kDa
• Observed Molecular Weight: 116-125 kDa
• GenBank Accession Number: BC007670
• Gene Symbol: MCM2
• Gene ID (NCBI): 4171
• RRID: AB_2142131
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P49736
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The MCM2-7 complex forms the core of the replicative helicase which acts as the molecular motor that uses ATP binding and hydrolysis to fuel the unwinding of double-stranded DNA at the replication fork in eukaryotes. This complex is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. MCM2, also named CDCL1 and BM28, is a human nuclear protein that plays an important role in 2 crucial steps of the cell cycle, namely, onset of DNA replication and cell division.