ME1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ME1 Polyclonal antibody, PBS Only (16619-1-PBS)

• 

  WB analysis using 16619-1-AP (same clone as 16619-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 16619-1-AP (ME1 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16619-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse placenta using 16619-1-AP (same clone as 16619-1-PBS)

  mouse placenta tissue were subjected to SDS PAGE followed by western blot with 16619-1-AP (ME1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16619-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 16619-1-AP (same clone as 16619-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 16619-1-AP (ME1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16619-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 16619-1-AP (same clone as 16619-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 16619-1-AP (ME1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16619-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 16619-1-AP (same clone as 16619-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 16619-1-AP (ME1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16619-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse liver using 16619-1-AP (same clone as 16619-1-PBS)

  IP result of anti-ME1 (IP:16619-1-AP, 4ug; Detection:16619-1-AP 1:2000) with mouse liver tissue lysate 2400 ug. This data was developed using the same antibody clone with 16619-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 16619-1-AP (same clone as 16619-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver using 16619-1-AP (ME1 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 16619-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 16619-1-AP (same clone as 16619-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver using 16619-1-AP (ME1 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 16619-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 16619-1-AP (same clone as 16619-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta using 16619-1-AP (ME1 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 16619-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 16619-1-AP (same clone as 16619-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta using 16619-1-AP (ME1 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 16619-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 16619-1-AP (same clone as 16619-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver using 16619-1-AP (ME1 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 16619-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 16619-1-AP (same clone as 16619-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver using 16619-1-AP (ME1 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 16619-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 16619-1-AP (same clone as 16619-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using ME1 antibody (16619-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 16619-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ME1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 16619-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

EC:1.1.1.40, Malic enzyme 1, NADP-dependent malic enzyme, NADP-ME

---

Product Information

16619-1-PBS targets ME1 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9916

  Product name: Recombinant human ME1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 226-572 aa of BC025246

  Sequence: DEFMEAVSSKYGMNCLIQFEDFANVNAFRLLNKYRNQYCTFNDDIQGTASVAVAGLLAALRITKNKLSDQTILFQGAGEAALGIAHLIVMALEKEGLPKEKAIKKIWLVDSKGLIVKGRASLTQEKEKFAHEHEEMKNLEAIVQEIKPTALIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYKITKGRAIFASGSPFDPVTLPNGQTLYPGQGNNSYVFPGVALGVVACGLRQITDNIFLTTAEVIAQQVSDKHLEEGRLYPPLNTIRDVSLKIAEKIVKDAYQEKTATVYPEPQNKEAFVRSQMYSTDYDQILPDCYSWPEEVQKIQTKVDQ

• Full Name: malic enzyme 1, NADP(+)-dependent, cytosolic
• Calculated Molecular Weight: 572 aa, 64 kDa
• Observed Molecular Weight: 55-64 kDa
• GenBank Accession Number: BC025246
• Gene Symbol: ME1
• Gene ID (NCBI): 4199
• RRID: AB_2143821
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P48163
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ME1(NADP-dependent malic enzyme) belongs to the malic enzymes family. This malic enzyme catalyzes the reversible oxidative decarboxylation of malate and is a link between the glycolytic pathway and the citric acid cycle. The reaction is L-malate plus NADP(+) to form pyruvate, CO(2), and NADPH. The predicted protein contains 572 amino acids and has a calculated molecular mass of 64.1 kDa.