MED26 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MED26 Polyclonal antibody, PBS Only (21043-1-PBS)

• 

  WB analysis using 21043-1-AP (same clone as 21043-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21043-1-AP (MED26 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21043-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse ovary using 21043-1-AP (same clone as 21043-1-PBS)

  mouse ovary tissue were subjected to SDS PAGE followed by western blot with 21043-1-AP (MED26 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21043-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 21043-1-AP (same clone as 21043-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 21043-1-AP (MED26 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21043-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

MED26 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 21043-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Activator-recruited cofactor 70 kDa component, ARC70, CRSP7, CRSP70

---

Product Information

21043-1-PBS targets MED26 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15381

  Product name: Recombinant human MED26 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 251-600 aa of BC110430

  Sequence: QQLDRVDETPGPPHPKGPPRCSFSPRNSRHEGSFARQQSLYAPKGSVPSPSPRPQALDATQVPSPLPLAQPSTPPVRRLELLPSAESPVCWLEQPESHQRLAGPGCKAGLSPAEPLLSLAGFSPDSSKADSDAASSGGSDSKKKKRYRPRDYTVNLDGQVAEAGVKPVRLKERKLTFDPMTRQIKPLTQKEPVRADSPVHMEQQSRTELDKQEAKASLQSPFEQTNWKELSRNEIIQSYLSRQSSLLSSSGAQTPGAHHFMSEYLKQEESTRQGARQLHVLVPQSPPTDLPGLTREVTQDDLDRIQASQWPGVNGCQDTQGNWYDWTQCISLDPHGDDGRLNILPYVCLD

• Full Name: mediator complex subunit 26
• Calculated Molecular Weight: 600 aa, 65 kDa
• Observed Molecular Weight: 66-70 kDa
• GenBank Accession Number: BC110430
• Gene Symbol: MED26
• Gene ID (NCBI): 9441
• RRID: AB_10733342
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95402
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MED26 (Mediator complex subunit 26), also known as ARC70 or CRSP7, is a metazoan-specific Mediator subunit essential for transcription regulation. MED26 plays a critical role in the transition from transcription initiation to elongation. It acts as a molecular switch, with its conserved N-terminal domain facilitating the exchange of the initiation factor TFIID for the super elongation complex (SEC), which contains factors such as ELL/EAF and P-TEFb, thereby promoting RNA polymerase II elongation (PMID: 21729782, PMID: 33836240).