• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated MED30 Monoclonal antibody

MED30 Monoclonal Antibody for FC (Intra)
Cat No. CL488-67038
Clone No.1D7C4

Host / Isotype

Mouse / IgG2a

Reactivity

Human, rat, pig

Applications

FC (Intra)

Thyroid hormone receptor-associated protein complex 25 kDa component, Thyroid hormone receptor-associated protein 6, THRAP6, Mediator of RNA polymerase II transcription subunit 30, Mediator complex subunit 30

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67038 targets MED30 in FC (Intra) applications and shows reactivity with Human, rat, pig samples.

Tested Reactivity Human, rat, pig
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag10235

Product name: Recombinant human MED30 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-178 aa of BC008226

Sequence: MSTPPLAASGMAPGPFAGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTYHTGTYQDRLTKLQDNLRQLSVLFRKLRLVYDKCNENCGGMDPIPVEQLIPYVEEDGSKNDDRAGPPRFASEERREIAEVNKKLKQKNQQLKQIMDQLRNLIWDINAMLAMRN

Predict reactive species
Full Name mediator complex subunit 30
Calculated Molecular Weight 178 aa, 20 kDa
Observed Molecular Weight 20-25 kDa
GenBank Accession NumberBC008226
Gene Symbol MED30
Gene ID (NCBI) 90390
RRIDAB_2934515
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ96HR3
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

MED30, also named as THRAP6 and TRAP25, is a component of the Mediator complex. MED30 has two isoforms with MW 16-20 kDa ad 20-25 kDa.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 MED30 antibody CL488-67038Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...