CoraLite® Plus 488-conjugated MED30 Monoclonal antibody

• 

  FC experiment of HeLa using CL488-67038

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug CoraLite® Plus 488 Anti-Human MED30 (CL488-67038, Clone:1D7C4) (red), or 0.4 ug Mouse IgG2a Isotype Control (CL488-66360-2, Clone: K11A1B2A2) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

• Featured Product
• KD/KO Validated

MED30 Monoclonal Antibody for FC (Intra)

Cat No. CL488-67038

Clone No.1D7C4

Host / Isotype

Mouse / IgG2a

Reactivity

Human, rat, pig

Applications

FC (Intra)

Synonyms

Thyroid hormone receptor-associated protein complex 25 kDa component, Thyroid hormone receptor-associated protein 6, THRAP6, Mediator of RNA polymerase II transcription subunit 30, Mediator complex subunit 30

---

Tested Applications

• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67038 targets MED30 in FC (Intra) applications and shows reactivity with Human, rat, pig samples.

• Tested Reactivity: Human, rat, pig
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10235

  Product name: Recombinant human MED30 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-178 aa of BC008226

  Sequence: MSTPPLAASGMAPGPFAGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTYHTGTYQDRLTKLQDNLRQLSVLFRKLRLVYDKCNENCGGMDPIPVEQLIPYVEEDGSKNDDRAGPPRFASEERREIAEVNKKLKQKNQQLKQIMDQLRNLIWDINAMLAMRN

• Full Name: mediator complex subunit 30
• Calculated Molecular Weight: 178 aa, 20 kDa
• Observed Molecular Weight: 20-25 kDa
• GenBank Accession Number: BC008226
• Gene Symbol: MED30
• Gene ID (NCBI): 90390
• RRID: AB_2934515
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96HR3
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

MED30, also named as THRAP6 and TRAP25, is a component of the Mediator complex. MED30 has two isoforms with MW 16-20 kDa ad 20-25 kDa.