MED31 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MED31 Polyclonal antibody, PBS Only (16590-1-PBS)

• 

  WB analysis of mouse testis using 16590-1-AP (same clone as 16590-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 16590-1-AP (MED31 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16590-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 16590-1-AP (same clone as 16590-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 16590-1-AP (MED31 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16590-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 16590-1-AP (same clone as 16590-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using MED31 antibody (16590-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 16590-1-PBS in a different storage buffer formulation.

MED31 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 16590-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

16590-1-PBS targets MED31 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9008

  Product name: Recombinant human MED31 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-131 aa of BC012539

  Sequence: MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKDPEYAKYLKYPQCLHMLELLQYEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRLQQALAEQQQQNNTSGK

• Full Name: mediator complex subunit 31
• Calculated Molecular Weight: 131 aa, 16 kDa
• Observed Molecular Weight: 16 kDa
• GenBank Accession Number: BC012539
• Gene Symbol: MED31
• Gene ID (NCBI): 51003
• RRID: AB_2142447
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y3C7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MED31, also named as SOH1 or CGI-125, is a 131 amino acid protein, which belongs to the Mediator complex subunit 31 family. MED31 localizes in the nucleus. MED31 as a component of the Mediator complex, a coactivator is involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. MED31 functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery.