CoraLite® Plus 488-conjugated MEF2C Polyclonal antibody

MEF2C Polyclonal Antibody for IF-P
Cat No. CL488-20326

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P

MEF2C, myocyte enhancer factor 2C

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse brain tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-20326 targets MEF2C in IF-P applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag13255

Product name: Recombinant human MEF2C protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-162 aa of BC026341

Sequence: PSLQRNSMSPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNSPGLLVSPGNLNKNMQAKSPPPMNLGMNNRKPDLRVLIPPGSKNTMPSVSEDVDLLLNQRINNSQSAQSLATPVVSVATPTLPGQGMGGYPSAISTTYGTEYSLSSADLSSLSGF

Predict reactive species
Full Name myocyte enhancer factor 2C
Calculated Molecular Weight 469 aa, 51 kDa
Observed Molecular Weight 65-68 kDa
GenBank Accession NumberBC026341
Gene Symbol MEF2C
Gene ID (NCBI) 4208
RRIDAB_3084032
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen Affinity Purified
UNIPROT IDQ06413
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

MEF2C belongs to the MEF2 family. It is a transcription activator which binds specifically to the MEF2 element present in the regulatory regions of many muscle-specific genes. MEF2C controls cardiac morphogenesis and myogenesis, and is also involved in vascular development. It plays an essential role in hippocampal-dependent learning and memory by suppressing the number of excitatory synapses and thus regulating basal and evoked synaptic transmission. It is crucial for normal neuronal development, distribution, and electrical activity in the neocortex and is necessary for proper development of megakaryocytes and platelets and for bone marrow B lymphopoiesis. This protein is required for B-cell survival and proliferation in response to BCR stimulation, efficient IgG1 antibody responses to T-cell-dependent antigens and for normal induction of germinal center B cells. It may also be involved in neurogenesis and in the development of cortical architecture. This antibody is a rabbit polyclonal antibody raised against an internal 161Aa region of human MEF2C.Phosphorylation and acetylation may affect the molecular weight of protein,and 60-70kd was also been reported(PMID:28973134).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 MEF2C antibody CL488-20326Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...