MEF2D Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85801-5-RR (same clone as 85801-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85801-5-RR (MEF2D antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85801-5-PBS in a different storage buffer formulation.

• 

  WB analysis using 85801-5-RR (same clone as 85801-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85801-5-RR (MEF2D antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85801-5-PBS in a different storage buffer formulation.

• 

  WB analysis using 85801-5-RR (same clone as 85801-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85801-5-RR (MEF2D antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85801-5-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 85801-5-RR (same clone as 85801-5-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 85801-5-RR (MEF2D antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85801-5-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 85801-5-RR (same clone as 85801-5-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 85801-5-RR (MEF2D antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85801-5-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 85801-5-RR (same clone as 85801-5-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using MEF2D antibody (85801-5-RR, Clone: 250068B7 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 85801-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85801-5-RR

  Biolayer interferometry (BLl) kinetic assays of 85801-5-RR against Human MEF2D were performed. The affinity constant is 1.99 nM.

MEF2D Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 85801-5-PBS

Clone No.250068B7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Myocyte-specific enhancer factor 2D

---

Product Information

85801-5-PBS targets MEF2D in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag5700

  Product name: Recombinant human MEF2D protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 167-514 aa of BC040949

  Sequence: SLVTSSLTDPRLLSPQQPALQRNSVSPGLPQRPASAGAMLGGDLNSANGACPSPVGNGYVSARASPGLLPVANGNSLNKVIPAKSPPPPTHSTQLGAPSRKPDLRVITSQAGKGLMHHLNNAQRLGVSQSTHSLTTPVVSVATPSLLSQGLPFSSMPTAYNTDYQLTSAELSSLPAFSSPGGLSLGNVTAWQQPQQPQQPQQPQPPQQQPPQPQQPQPQQPQQPQQPPQQQSHLVPVSLSNLIPGSPLPHVGAALTVTTHPHISIKSEPVSPSRERSPAPPPPAVFPAARPEPGDGLSSPAGGSYETGDRDDGRGDFGPTLGLLRPAPEPEAEGSAVKRMRLDTWTLK

• Full Name: myocyte enhancer factor 2D
• Calculated Molecular Weight: 56 kDa
• Observed Molecular Weight: 55-60 kDa
• GenBank Accession Number: BC040949
• Gene Symbol: MEF2D
• Gene ID (NCBI): 4209
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q14814
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MEF2D, also named as Myocyte-specific enhancer factor 2D, is a 521 amino acid protein, which belongs to the MEF2 family. MEF2D is expressed in t in myotubes and also in undifferentiated myoblasts. MEF2D as a transcriptional activator which binds specifically to the MEF2 element, found in numerous muscle-specific and stress-induced genes. MEF2D mediates cellular functions not only in skeletal and cardiac muscle development, but also in neuronal differentiation and survival. The calculated molecular weight of MEF2D is 55 kDa, but Phosphorylated MEF2D is 60 kDa.