CoraLite® Plus 488-conjugated MEF2D Recombinant monoclonal antibody

MEF2D Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-85801-5
Clone No.250068B7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Myocyte-specific enhancer factor 2D

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-85801-5 targets MEF2D in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag5700

Product name: Recombinant human MEF2D protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 167-514 aa of BC040949

Sequence: SLVTSSLTDPRLLSPQQPALQRNSVSPGLPQRPASAGAMLGGDLNSANGACPSPVGNGYVSARASPGLLPVANGNSLNKVIPAKSPPPPTHSTQLGAPSRKPDLRVITSQAGKGLMHHLNNAQRLGVSQSTHSLTTPVVSVATPSLLSQGLPFSSMPTAYNTDYQLTSAELSSLPAFSSPGGLSLGNVTAWQQPQQPQQPQQPQPPQQQPPQPQQPQPQQPQQPQQPPQQQSHLVPVSLSNLIPGSPLPHVGAALTVTTHPHISIKSEPVSPSRERSPAPPPPAVFPAARPEPGDGLSSPAGGSYETGDRDDGRGDFGPTLGLLRPAPEPEAEGSAVKRMRLDTWTLK

Predict reactive species
Full Name myocyte enhancer factor 2D
Calculated Molecular Weight 56 kDa
Observed Molecular Weight 55-60 kDa
GenBank Accession NumberBC040949
Gene Symbol MEF2D
Gene ID (NCBI) 4209
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ14814
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

MEF2D, also named as Myocyte-specific enhancer factor 2D, is a 521 amino acid protein, which belongs to the MEF2 family. MEF2D is expressed in t in myotubes and also in undifferentiated myoblasts. MEF2D as a transcriptional activator which binds specifically to the MEF2 element, found in numerous muscle-specific and stress-induced genes. MEF2D mediates cellular functions not only in skeletal and cardiac muscle development, but also in neuronal differentiation and survival. The calculated molecular weight of MEF2D is 55 kDa, but Phosphorylated MEF2D is 60 kDa.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 MEF2D antibody CL488-85801-5Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...