MEGF8 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MEGF8 Polyclonal antibody, PBS Only (32300-1-PBS)

• 

  WB analysis using 32300-1-AP (same clone as 32300-1-PBS)

  Various lysates were subjected to Tris-Acetate gel system followed by western blot with 32300-1-AP (MEGF8 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32300-1-PBS in a different storage buffer formulation.

MEGF8 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 32300-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

C19orf49, EGFL4, EGF-like protein 4, Epidermal growth factor-like protein 4, KIAA0817

---

Product Information

32300-1-PBS targets MEGF8 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36469

  Product name: Recombinant human MEGF8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2442-2647 aa of NM_001271938.1

  Sequence: YRLISVEQECCLDPTSQTNCFHEPKRRALGPGRTVLFGVQPKFTNVDIRLTLDVTFGAVDLYVSTSYDTFVVRVAPDTGVHTVHIQPPPAPPPPPPPADGGPRGAGDPGGAGASSGPGAPAEPRVREVWPRGLITYVTVTEPSAVLVVRGVRDRLVITYPHEHHALKSSRFYLLLLGVGDPSGPGANGSADSQGLLFFRQDQAHID

• Full Name: multiple EGF-like-domains 8
• Calculated Molecular Weight: 303 kDa
• Observed Molecular Weight: 303 kDa
• GenBank Accession Number: NM_001271938.1
• Gene Symbol: MEGF8
• Gene ID (NCBI): 1954
• RRID: AB_3670233
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q7Z7M0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Multiple epidermal growth factor-like domains protein 8 (MEGF8, also known as C19orf49, EGFL4, and KIAA0817) is a multidomain transmembrane protein, which is known to interact with MGRN1, a protein that functions as an E3 ubiquitin ligase, and this interaction is involved in the regulation of Hedgehog signaling and heart development (PMID: 32966817). It is also involved in mediating Bone morphogenetic protein 4 (BMP4) signaling and guidance of developing trigeminal ganglion (TG) axons (PMID: 24052814). Immunoelectron microscopy showed that MEGF8 was present in the synapses and around the outer mitochondrial membrane, indicating its role in synaptic and mitochondrial functions (PMID: 38201267).