MEPCE Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MEPCE Polyclonal antibody (14917-1-AP)

• Featured Product
• KD/KO Validated

MEPCE Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 14917-1-AP Copied!

Publications (10)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, IP, ELISA

Synonyms

EC:2.1.1.-, Bicoid-interacting protein 3 homolog, BCDIN3

• 

  WB analysis of MCF-7 using 14917-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 14917-1-AP (MEPCE antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 14917-1-AP

  WB result of MEPCE antibody (14917-1-AP; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-MEPCE transfected MCF-7 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of MCF-7 using 14917-1-AP

  IP result of anti-MEPCE (IP:14917-1-AP, 4ug; Detection:14917-1-AP 1:400) with MCF-7 cells lysate 3200ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MCF-7 using 14917-1-AP

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using MEPCE antibody (14917-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MEPCE in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: MCF7 cells, MCF-7 cells
• Positive IP detected in: MCF-7 cells
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14917-1-AP targets MEPCE in WB, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6733

  Product name: Recombinant human MEPCE protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 340-689 aa of BC000556

  Sequence: SGSLSAPPAASVISAPPSSSSRHRKRRRTSSKSEAGARGGGQGSKEKGRGSWGGRHHHHHPLPAAGFKKQQRKFQYGNYCKYYGYRNPSCEDGRLRVLKPEWFRGRDVLDLGCNVGHLTLSIACKWGPSRMVGLDIDSRLIHSARQNIRHYLSEELRLPPQTLEGDPGAEGEEGTTTVRKRSCFPASLTASRGPIAAPQVPLDGADTSVFPNNVVFVTGNYVLDRDDLVEAQTPEYDVVLCLSLTKWVHLNWGDEGLKRMFRRIYRHLRPGGILVLEPQPWSSYGKRKTLTETIYKNYYRIQLKPEQFSSYLTSPDVGFSSYELVATPHNTSKGFQRPVYLFHKARSPSH

• Full Name: methylphosphate capping enzyme
• Calculated Molecular Weight: 74 kDa
• Observed Molecular Weight: 74 kDa
• GenBank Accession Number: BC000556
• Gene Symbol: MEPCE
• Gene ID (NCBI): 56257
• RRID: AB_2250635
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7L2J0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MEPCE is a somponent of the 7SK snRNP complex, and a S-adenosyl-L-methionine-dependent methyltransferase that adds a methylphosphate cap at the 5'-end of 7SK snRNA, which leads to its stabilization.

Publications

What published studies show

The MEPCE Polyclonal antibody (Cat# 14917-1-AP) has 10 citations published in journals including Nature Communications, Molecular Cell, Science Advances, EMBO Reports, mBio, Scientific Reports, ACS Chemical Biology, Vaccines, and FEBS Letters. Research fields span RNA modification (m6A/methylphosphate capping), transcription elongation regulation, 7SK snRNP biology, neurodevelopmental disorders, viral transcription (HSV-1, HIV-1), and chemoproteomics.

Automatically generated from the 10 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	IP	Nat Commun; Interaction of 7SK with the Smn complex modulates snRNP production.; Authors - Changhe Ji
human	IP	Nat Commun; Pseudouridylation of 7SK by PUS7 regulates Pol II transcription elongation.; Authors - Yutao Zhao ; KD Validated
human	WB	Mol Cell; N6-methyladenosine in 7SK small nuclear RNA underlies RNA polymerase II transcription regulation; Authors - Yuzhi Wang
human	WB	Sci Adv; 7SK methylation by METTL3 promotes transcriptional activity; Authors - Marcelo Perez-Pepe
human	WB	EMBO Rep; Human METTL16 is a N6-methyladenosine (m6A) methyltransferase that targets pre-mRNAs and various non-coding RNAs.; Authors - Ahmed S Warda
human	WB	MBio; Interaction of the Ankyrin H Core Effector of Legionella with the Host LARP7 Component of the 7SK snRNP Complex.; Authors - Juanita Von Dwingelo