MEPCE Polyclonal antibody

• 

  WB analysis of MCF-7 using 14917-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 14917-1-AP (MEPCE antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 14917-1-AP

  WB result of MEPCE antibody (14917-1-AP; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-MEPCE transfected MCF-7 cells.

• 

  IP experiment of MCF-7 using 14917-1-AP

  IP result of anti-MEPCE (IP:14917-1-AP, 4ug; Detection:14917-1-AP 1:400) with MCF-7 cells lysate 3200ug.

• 

  IF Staining of MCF-7 using 14917-1-AP

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using MEPCE antibody (14917-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red).

• Featured Product
• KD/KO Validated

MEPCE Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 14917-1-AP

Publications(9)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, IP, ELISA

Synonyms

EC:2.1.1.-, Bicoid-interacting protein 3 homolog, BCDIN3

---

Tested Applications

• Positive WB detected in: MCF7 cells, MCF-7 cells
• Positive IP detected in: MCF-7 cells
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 8 publications below
• IP: See 1 publications below

Product Information

14917-1-AP targets MEPCE in WB, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6733

  Product name: Recombinant human MEPCE protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 340-689 aa of BC000556

  Sequence: SGSLSAPPAASVISAPPSSSSRHRKRRRTSSKSEAGARGGGQGSKEKGRGSWGGRHHHHHPLPAAGFKKQQRKFQYGNYCKYYGYRNPSCEDGRLRVLKPEWFRGRDVLDLGCNVGHLTLSIACKWGPSRMVGLDIDSRLIHSARQNIRHYLSEELRLPPQTLEGDPGAEGEEGTTTVRKRSCFPASLTASRGPIAAPQVPLDGADTSVFPNNVVFVTGNYVLDRDDLVEAQTPEYDVVLCLSLTKWVHLNWGDEGLKRMFRRIYRHLRPGGILVLEPQPWSSYGKRKTLTETIYKNYYRIQLKPEQFSSYLTSPDVGFSSYELVATPHNTSKGFQRPVYLFHKARSPSH

• Full Name: methylphosphate capping enzyme
• Calculated Molecular Weight: 74 kDa
• Observed Molecular Weight: 74 kDa
• GenBank Accession Number: BC000556
• Gene Symbol: MEPCE
• Gene ID (NCBI): 56257
• RRID: AB_2250635
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7L2J0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MEPCE is a somponent of the 7SK snRNP complex, and a S-adenosyl-L-methionine-dependent methyltransferase that adds a methylphosphate cap at the 5'-end of 7SK snRNA, which leads to its stabilization.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Sci Adv; 7SK methylation by METTL3 promotes transcriptional activity; Authors - Marcelo Perez-Pepe
	IP	Nat Commun; Interaction of 7SK with the Smn complex modulates snRNP production.; Authors - Changhe Ji
human	WB	EMBO Rep; Human METTL16 is a N6-methyladenosine (m6A) methyltransferase that targets pre-mRNAs and various non-coding RNAs.; Authors - Ahmed S Warda
human	WB	MBio; Interaction of the Ankyrin H Core Effector of Legionella with the Host LARP7 Component of the 7SK snRNP Complex.; Authors - Juanita Von Dwingelo
human	WB	Vaccines (Basel); HSV-1 ICP22 Is a Selective Viral Repressor of Cellular RNA Polymerase II-Mediated Transcription Elongation.; Authors - Nur Firdaus Isa
human	WB	Sci Rep; de novo MEPCE nonsense variant associated with a neurodevelopmental disorder causes disintegration of 7SK snRNP and enhanced RNA polymerase II activation.; Authors - Pauline E Schneeberger