CoraLite® Plus 488-conjugated MEPCE Polyclonal antibody

• 

  IF Staining of MCF-7 using CL488-14917

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using CoraLite® Plus 488 MEPCE antibody (CL488-14917) at dilution of 1:200, CL594-Phalloidin (red).

• Featured Product
• KD/KO Validated

MEPCE Polyclonal Antibody for IF/ICC

Cat No. CL488-14917

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

Bin3 homolog, FLJ20257, MEPCE, methylphosphate capping enzyme

---

Tested Applications

• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-14917 targets MEPCE in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6733

  Product name: Recombinant human MEPCE protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 340-689 aa of BC000556

  Sequence: SGSLSAPPAASVISAPPSSSSRHRKRRRTSSKSEAGARGGGQGSKEKGRGSWGGRHHHHHPLPAAGFKKQQRKFQYGNYCKYYGYRNPSCEDGRLRVLKPEWFRGRDVLDLGCNVGHLTLSIACKWGPSRMVGLDIDSRLIHSARQNIRHYLSEELRLPPQTLEGDPGAEGEEGTTTVRKRSCFPASLTASRGPIAAPQVPLDGADTSVFPNNVVFVTGNYVLDRDDLVEAQTPEYDVVLCLSLTKWVHLNWGDEGLKRMFRRIYRHLRPGGILVLEPQPWSSYGKRKTLTETIYKNYYRIQLKPEQFSSYLTSPDVGFSSYELVATPHNTSKGFQRPVYLFHKARSPSH

• Full Name: methylphosphate capping enzyme
• Calculated Molecular Weight: 74 kDa
• Observed Molecular Weight: 74 kDa
• GenBank Accession Number: BC000556
• Gene Symbol: MEPCE
• Gene ID (NCBI): 56257
• RRID: AB_3672611
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7L2J0
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

MEPCE is a somponent of the 7SK snRNP complex, and a S-adenosyl-L-methionine-dependent methyltransferase that adds a methylphosphate cap at the 5'-end of 7SK snRNA, which leads to its stabilization.