METTL10 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• METTL10 Polyclonal antibody, PBS Only (33763-1-PBS)

• 

  WB analysis using 33763-1-AP (same clone as 33763-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 33763-1-AP (METTL10 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33763-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 33763-1-AP (same clone as 33763-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 33763-1-AP (METTL10 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 33763-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 33763-1-AP (same clone as 33763-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using METTL10 antibody (33763-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 33763-1-PBS in a different storage buffer formulation.

METTL10 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 33763-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

C10orf138, EEF1AKMT2

---

Product Information

33763-1-PBS targets METTL10 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37000

  Product name: Recombinant human METTL10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-192 aa of BC026167

  Sequence: MSSGADGGGGAAVAARSDKGSPGEDGFVPSALGTREHWDAVYERELQTFREYGDTGEIWFGEESMNRLIRWMQKHKIPLDASVLDIGTGNGVFLVELAKFGFSNITGIDYSPSAIQLSGSIIEKEGLSNIKLKVEDFLNLSTQLSGFHICIDKGTFDAISLNPDNAIEKRKQYVKSLSRVLKVKGFFSNNVM

• Full Name: methyltransferase like 10
• Observed Molecular Weight: 26 kDa
• GenBank Accession Number: BC026167
• Gene Symbol: METTL10
• Gene ID (NCBI): 399818
• RRID: AB_3743071
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q5JPI9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Methyltransferase-like 10 (METTL10) is a lysine trimethyltransferase targeting eukaryotic translation elongation factor 1A1 (eEF1A1), which is well preserved from simple eukaryotes such as Saccharomyces cerevisiae to mammals such as humans and mice. Recently, METTL10was identified as an estimated glomerular filtration rate (eGFR)-associated gene through a transethnic genome-wide association study of eGFR. (PMID: 39774961)