• Featured Product
  • KD/KO Validated

METTL3 Monoclonal antibody

METTL3 Monoclonal Antibody for WB, IHC, IF-P, FC (Intra), ELISA
Cat No. 67733-1-Ig
Clone No.2D8H1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF-P, FC (Intra), IP, CoIP, RIP, ELISA

2D8H1, EC:2.1.1.348, hMETTL3, Methyltransferase-like protein 3, MT A70

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
HRP
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, A549 cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells
Positive IHC detected inhuman lung cancer tissue, human urothelial carcinoma tissue, human colon cancer tissue, human oesophagus cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse testis tissue
Positive FC (Intra) detected inHEK-293 cells

This antibody is not recommended for immunocytofluorescent assays.

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67733-1-Ig targets METTL3 in WB, IHC, IF-P, FC (Intra), IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7110

Product name: Recombinant human METTL3 protein

Source: e coli.-derived, T-HIS

Tag: 6*His

Domain: 229-580 aa of BC001650

Sequence: LNQQSTKEQQSKKVSQEILELLNTTTAKEQSIVEKFRSRGRAQVQEFCDYGTKEECMKASDADRPCRKLHFRRIINKHTDESLGDCSFLNTCFHMDTCKYVHYEIDACMDSEAPGSKDHTPSQELALTQSVGGDSSADRLFPPQWICCDIRYLDVSILGKFAVVMADPPWDIHMELPYGTLTDDEMRRLNIPVLQDDGFLFLWVTGRAMELGRECLNLWGYERVDEIIWVKTNQLQRIIRTGRTGHWLNHGKEHCLVGVKGNPQGFNQGLDCDVIVAEVRSTSHKPDEIYGMIERLSPGTRKIELFGRPHNVQPNWITLGNQLDGIHLLDPDVVARFKQRYPDGIISKPKNL

Predict reactive species
Full Name methyltransferase like 3
Calculated Molecular Weight 64 kDa
Observed Molecular Weight 65-70 kDa
GenBank Accession NumberBC001650
Gene Symbol METTL3
Gene ID (NCBI) 56339
RRIDAB_2918502
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ86U44
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

METTL3 is a key S-adenosyl-L-methionine-binding subunit, which is component of a complex multicomponent enzyme that catalyzes the methylation of internal adenosine residues in eukaryotic mRNA, forming N6-methyladenosine. It contains 2 putative nuclear localization signals and 2 consensus methylation motifs. The calculated molecular weight of METTL3 is 64 kDa, but modified METTL3 is about 65-70 kDa.

Protocols

Product Specific Protocols
FC protocol for METTL3 antibody 67733-1-IgDownload protocol
IF protocol for METTL3 antibody 67733-1-IgDownload protocol
IHC protocol for METTL3 antibody 67733-1-IgDownload protocol
WB protocol for METTL3 antibody 67733-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Environ Pollut

RNA reading protein YTHDF2 mediates Benzo(k)fluoranthene induced male reproductive injury by regulating the stability of BCL2

Authors - Ya-Wen Li
mouseWB

EMBO Rep

DDX5 inhibits inflammation by modulating m6A levels of TLR2/4 transcripts during bacterial infection

Authors - Jian Xu
humanIP

Cancer Lett

Therapeutic targeting m6A-guided miR-146a-5p signaling contributes to the melittin-induced selective suppression of bladder cancer.

Authors - Rucheng Yan
humanWB,IP,IF

J Invest Dermatol

NPTX2 Promotes EMT in Cutaneous Squamous Cell Carcinoma via Mettl3-Mediated m6A Methylation of Snail

Authors - Tong Kang
mouse,humanWB,IF

Am J Respir Cell Mol Biol

The Combined Effects of Circular RNA Methylation Promote Pulmonary Fibrosis.

Authors - Sha Wang
  • KD Validated
humanIHC

Transl Oncol

METTL3 methylated KIF15 promotes nasopharyngeal carcinoma progression and radiation resistance by blocking ATG7-mediated autophagy through the activation of STAT3 pathway

Authors - Siwei Li
Loading...
||
New chat Able
正在加载,请稍候...