METTL8 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• METTL8 Polyclonal antibody, PBS Only (31173-1-PBS)

• 

  WB analysis using 31173-1-AP (same clone as 31173-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31173-1-AP (METTL8 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31173-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 31173-1-AP (same clone as 31173-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using METTL8 antibody (31173-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 31173-1-PBS in a different storage buffer formulation.

METTL8 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 31173-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

methyltransferase like 8

---

Product Information

31173-1-PBS targets METTL8 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34222

  Product name: Recombinant human METTL8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-77 aa of BC025250

  Sequence: MNMIWRNSISCLRLGKVPHRYQSGYHPVAPLGSRILTDPAKVFEHNMWDHMQWSKEEEAAARKKVKENSAVRVLLEE

• Full Name: methyltransferase like 8
• Calculated Molecular Weight: 33 kDa
• Observed Molecular Weight: 33~40 kDa
• GenBank Accession Number: BC025250
• Gene Symbol: METTL8
• Gene ID (NCBI): 79828
• RRID: AB_3669881
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9H825
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

METTL8 (methyltransferase-like protein 8) is an m3C methyltransferase that is best known for its mitochondrial role in installing m3C32 on mt-tRNAThr/Ser(UCN). METTL8 has proved to be a transcriptional target of STAT3 that mediates STAT3's functions in mESCs (PMID: 29706498). METTL8 has multiple splicing isoforms and can undergo sumoylation and associate with nuclear RNA-binding proteins to regulate R-loop formation on ribosomal DNA gene (presumably via its methyltransferase activity on m3C) (PMID: 38744809).