METTL9 Recombinant monoclonal antibody

• 

  WB analysis using 83531-5-RR

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 83531-5-RR (METTL9 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  FC experiment of HepG2 using 83531-5-RR

  1x10^6 HepG2 cells were intracellularly stained with 0.25 ug METTL9 Recombinant antibody (83531-5-RR, Clone:240510A2) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• 

  Affinity and Kinetic Characterization of 83531-5-RR

  Biolayer interferometry (BLl) kinetic assays of 83531-5-RR against Human METTL9 were performed. The affinity constant is below 1 pM.

METTL9 Uni-rAb^® Recombinant Antibody for WB, FC (Intra), ELISA

Cat No. 83531-5-RR

Clone No.240510A2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), ELISA

Synonyms

240510A2, CGI 81, CGI81, CGI-81, DREV

---

Tested Applications

• Positive WB detected in: HEK-293 cells
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83531-5-RR targets METTL9 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag7191

  Product name: Recombinant human METTL9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 36-318 aa of BC000195

  Sequence: MTSGPGGPAAAAGGRKENHQWYVCNREKLCESLQAVFVQSYLDQGTQIFLNNSIEKSGWLFIQLYHSFVSSVFSLFMSRTSINGLLGRGSMFVFSPDQFQRLLKINPDWKTHRLLDLGAGDGEVTKIMSPHFEEIYATELSETMIWQLQKKKYRVLGINEWQNTGFQYDVISCLNLLDRCDQPLTLLKDIRSVLEPTRGRVILALVLPFHPYVENVGGKWEKPSEILEIKGQNWEEQVNSLPEVFRKAGFVIEAFTRLPYLCEGDMYNDYYVLDDAVFVLKPV

• Full Name: methyltransferase like 9
• Calculated Molecular Weight: 37 kDa
• Observed Molecular Weight: 40-45 kDa
• GenBank Accession Number: BC000195
• Gene Symbol: METTL9
• Gene ID (NCBI): 51108
• RRID: AB_3671156
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9H1A3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

METTL9 is a broad-specificity methyltransferase that mediates the formation of the majority of 1-methylhistidine(1MH) present in mouse and human proteomes.