METTL9 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• METTL9 Recombinant monoclonal antibody (83531-5-RR)

METTL9 Uni-rAb^® Recombinant Antibody for WB, FC (Intra), ELISA

Cat No. 83531-5-RR Copied!

Clone No. 240510A2

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, FC (Intra), ELISA

Synonyms

240510A2, CGI 81, CGI81, CGI-81, DREV

• 

  WB analysis using 83531-5-RR

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 83531-5-RR (METTL9 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of HepG2 using 83531-5-RR

  1x10^6 HepG2 cells were intracellularly stained with 0.25 ug METTL9 Recombinant antibody (83531-5-RR, Clone:240510A2) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity and Kinetic Characterization of 83531-5-RR

  Biolayer interferometry (BLl) kinetic assays of 83531-5-RR against Human METTL9 were performed. The affinity constant is below 1 pM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for METTL9 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83531-5-RR targets METTL9 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag7191

  Product name: Recombinant human METTL9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 36-318 aa of BC000195

  Sequence: MTSGPGGPAAAAGGRKENHQWYVCNREKLCESLQAVFVQSYLDQGTQIFLNNSIEKSGWLFIQLYHSFVSSVFSLFMSRTSINGLLGRGSMFVFSPDQFQRLLKINPDWKTHRLLDLGAGDGEVTKIMSPHFEEIYATELSETMIWQLQKKKYRVLGINEWQNTGFQYDVISCLNLLDRCDQPLTLLKDIRSVLEPTRGRVILALVLPFHPYVENVGGKWEKPSEILEIKGQNWEEQVNSLPEVFRKAGFVIEAFTRLPYLCEGDMYNDYYVLDDAVFVLKPV

• Full Name: methyltransferase like 9
• Calculated Molecular Weight: 37 kDa
• Observed Molecular Weight: 40-45 kDa
• GenBank Accession Number: BC000195
• Gene Symbol: METTL9
• Gene ID (NCBI): 51108
• RRID: AB_3671156
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9H1A3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

METTL9 is a broad-specificity methyltransferase that mediates the formation of the majority of 1-methylhistidine(1MH) present in mouse and human proteomes.

Publications

What published studies show

The antibody catalog number 83531-5-RR (Rabbit Recombinant) has 1 total citation. It appears in NPJ Precision Oncology (IF 9.9, 2025), where it was used for IHC in human samples. The research field involves hepatocellular carcinoma, specifically exploring SIX2 targeting as a sensitization strategy for sorafenib treatment through the METTL9-SLC7A11 axis.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	NPJ Precis Oncol; Targeting SIX2 as a novel sensitization strategy of sorafenib treatment on advanced hepatocellular carcinoma through modulating METTL9-SLC7A11 axis; Authors - Junren Lu