MGLL Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MGLL Polyclonal antibody, PBS Only (14986-1-PBS)

• 

  WB analysis of HepG2 using 14986-1-AP (same clone as 14986-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 14986-1-AP (MGLL antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14986-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 14986-1-AP (same clone as 14986-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14986-1-AP (MGLL antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14986-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse liver using 14986-1-AP (same clone as 14986-1-PBS)

  IP result of anti-MGLL (IP:14986-1-AP, 4ug; Detection:14986-1-AP 1:300) with mouse liver tissue lysate 4000ug. This data was developed using the same antibody clone with 14986-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 14986-1-PBS

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 14986-1-AP (MGLL antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 14986-1-PBS

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 14986-1-AP (MGLL antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 14986-1-AP (same clone as 14986-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 14986-1-AP (MGLL antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14986-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 14986-1-AP (same clone as 14986-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 14986-1-AP (MGLL antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14986-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

MGLL Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 14986-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

EC:3.1.1.23, HU K5, HUK5, HU-K5, Monoacylglycerol lipase

---

Product Information

14986-1-PBS targets MGLL in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6970

  Product name: Recombinant human MGLL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-313 aa of BC000551

  Sequence: METGPEDPSSMPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP

• Full Name: monoglyceride lipase
• Calculated Molecular Weight: 33 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC000551
• Gene Symbol: MGLL
• Gene ID (NCBI): 11343
• RRID: AB_2143189
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: A0A0C4DFN3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MGLL (monoglyceride lipase) is also named as MAGL, HU-K5 and belongs to the monoacylglycerol lipase family. It converts monoacylglycerides to free fatty acids and glycerol and functions together with hormone-sensitive lipase (HSL) in the mobilization of fatty acids from the triglyceride stores of adipocytes. MGL protein is ubiquitously expressed in kidney, spleen, heart, liver, stomach, brain, lung, adrenal gland, adipose tissue and in brain,there are two bands of 33 kDa and 35 kDa can be detected. The single protein species expressed in muscle is larger (around 40 kDa) (PMID:11470505). This protein can exsit as a homodimer (PMID:19957260).