FcZero-rAb® Biotin Anti-Human MICA/MICB Rabbit Recombinant Antibody

• 

  FC experiment of HeLa cells using Biotin-FcA98110

  1x10^6 HeLa cells (left) or Jurkat cells (right) were surface stained with 0.25ug Biotin Anti-Human MICA/MICB Rabbit RecAb (Biotin-FcA98110, Clone: 240735D5) (red) or 0.25ug Isotype Control (blue), and Streptavidin-PE Conjugate (PE-PF00030). Cells were not fixed.

• Zero Fc receptor binding
• Site-specific conjugation
• One universal isotype

MICA/MICB FcZero-rAb^® Recombinant Antibody for FC, ELISA

Cat No. Biotin-FcA98110

Clone No.240735D5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC, ELISA

Synonyms

MICA, MIC A, MIC-A

---

Tested Applications

• Positive FC detected in: HeLa cells

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

Biotin-FcA98110 targets MICA/MICB in FC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1176

  Product name: Recombinant Human MICA protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 24-308 aa of /

  Sequence: EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQ

• Full Name: MHC class I polypeptide-related sequence A
• Calculated Molecular Weight: 43 kDa
• GenBank Accession Number: /
• Gene Symbol: MICA
• Gene ID (NCBI): 100507436
• Conjugate: Biotin
• Excitation/Emission Maxima Wavelengths: -
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q29983
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

Human MHC class I chain-related genes located within the HLA class I region of chromosome 6 encode MHC class I chain-related A and B (MICA and MICB) (PMID: 11429322). MICA and MICB are stress-inducible surface molecules that are not associated with β2-microglobulin and do not present peptides (PMID: 9497295). They are expressed in intestinal epithelium and many epithelial tumors (PMID: 10359807). MICA and MICB are ligands for NKG2D which is an activating receptor that is expressed on most natural killer (NK) cells, CD8 αβ T cells, and γδ T cells (PMID: 10426993; 11491531). This antibody recognizes both MICA and MICB.