• Zero Fc receptor binding
  • Site-specific conjugation
  • One universal isotype

FcZero-rAb® PE Anti-Human MICA/MICB Rabbit Recombinant Antibody

MICA/MICB FcZero-rAb® Recombinant Antibody for FC
Cat No. PE-FcA98110
Clone No.240735D5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

MICA, 240735D5, MIC A, MIC-A

Formulation:  PBS, Azide, BSA
PBS, Azide, BSA
Conjugate:  PE
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inHeLa cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 5 ul per 10^6 cells in 100 μl suspension
This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.
Sample-dependent, Check data in validation data gallery.

Product Information

PE-FcA98110 targets MICA/MICB in FC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1176

Product name: Recombinant Human MICA protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 24-308 aa of /

Sequence: EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQ

Predict reactive species
Full Name MHC class I polypeptide-related sequence A
Calculated Molecular Weight43 kDa
GenBank Accession Number/
Gene Symbol MICA
Gene ID (NCBI) 100507436
Conjugate PE Fluorescent Dye
Excitation/Emission Maxima Wavelengths496 nm, 565 nm / 578 nm
Excitation LaserBlue Laser (488 nm), Green Laser (532 nm), Yellow-Green Laser (561 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ29983
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

Human MHC class I chain-related genes located within the HLA class I region of chromosome 6 encode MHC class I chain-related A and B (MICA and MICB) (PMID: 11429322). MICA and MICB are stress-inducible surface molecules that are not associated with β2-microglobulin and do not present peptides (PMID: 9497295). They are expressed in intestinal epithelium and many epithelial tumors (PMID: 10359807). MICA and MICB are ligands for NKG2D which is an activating receptor that is expressed on most natural killer (NK) cells, CD8 αβ T cells, and γδ T cells (PMID: 10426993; 11491531). This antibody recognizes both MICA and MICB.

Protocols

Product Specific Protocols
FC protocol for PE MICA/MICB antibody PE-FcA98110Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...