MICALL2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MICALL2 Polyclonal antibody, PBS Only (24408-1-PBS)

• 

  WB analysis of PC-3 using 24408-1-AP (same clone as 24408-1-PBS)

  WB result of MICALL2 antibody (24408-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-MICALL2 transfected PC-3 cells. This data was developed using the same antibody clone with 24408-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 24408-1-AP (same clone as 24408-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24408-1-AP (MICALL2 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24408-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-3 using 24408-1-AP (same clone as 24408-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 24408-1-AP (MICALL2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24408-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

MICALL2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 24408-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

24408-1-PBS targets MICALL2 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19931

  Product name: Recombinant human MICALL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 306-605 aa of BC037988

  Sequence: PAATSATSVHVRSPARPSESRLAPTPTEGKVRPRVTNSSPMGWSSAAPCTAAAASHPAVPPSAPDPRPATPQGGGAPRVAAPQTTLSSSSTSAATVDPPAWTPSASRTQQARNKFFQTSAVPPGTSLSGRGPTPSLVLSKDSSKEQARNFLKQALSALEEAGAPAPGRPSPATAAVPSSQPKTEAPQASPLAKPLQSSSPRVLGLPSRMEPPAPLSTSSTSQASALPPAGRRNLAESSGVGRVGAGSRPKPEAPMAKGKSTTLTQDMSTSLQEGQEDGPAGWRANLKPVDRRSPAERTLK

• Full Name: MICAL-like 2
• Calculated Molecular Weight: 904 aa, 98 kDa
• Observed Molecular Weight: 109 kDa
• GenBank Accession Number: BC037988
• Gene Symbol: MICALL2
• Gene ID (NCBI): 79778
• RRID: AB_2879527
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IY33
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.