CoraLite® Plus 488-conjugated MIER2 Recombinant monoclonal antibody

• 

  IF Staining of A431 using CL488-84216

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using CoraLite® Plus 488 MIER2 antibody (CL488-84216, Clone: 241458D2 ) at dilution of 1:200, CL594-phalloidin (red).

MIER2 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-84216

Clone No.241458D2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

241458D2, KIAA1193, Mesoderm induction early response protein 2, Mi-er2

---

Tested Applications

• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-84216 targets MIER2 in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag11491

  Product name: Recombinant human MIER2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 197-545 aa of BC028203

  Sequence: IMVGPQFQADLSNLHLNRHCEKIYENEDQLLWDPSVLPEREVEEFLYRAVKRRWHEMAGPQLPEGEAVKDSEQALYELVKCNFNVEEALRRLRFNVKVIRDGLCAWSEEECRNFEHGFRVHGKNFHLIQANKVRTRSVGECVEYYYLWKKSERYDYFAQQTRLGRRKYVPSGTTDADQDLDGSDPDGPGRPRPEQDTLTGMRTDPLSVDGTAGGLDEPGVASDGLPSSEPGPCSFQQLDESPAVPLSHRPPALADPASYQPAVTAPEPDASPRLAVDFALPKELPLISSHVDLSGDPEETVAPAQVALSVTEFGLIGIGDVNPFLAAHPTCPAPGLHSEPLSHCNVMTC

• Full Name: mesoderm induction early response 1, family member 2
• Calculated Molecular Weight: 545 aa, 60 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC028203
• Gene Symbol: MIER2
• Gene ID (NCBI): 54531
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Excitation Laser: Blue laser (488 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8N344
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Mesoderm induction early response 2 (MIER2) is a member of the MIER family of proteins, which is relatively conservative in evolution and includes three members: MIER1, MIER2, and MIER3. The MIER family is known to contribute to histone deacetylase (HDAC) activity and actively participate in histone deacetylation (PMID: 28046085; PMID: 38702028). In renal cell carcinoma, MIER2 represses PGC1A expression by recruiting HDAC1 to deacetylate P53 (PMID: 28046085).