MKRN2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MKRN2 Polyclonal antibody, PBS Only (12238-1-PBS)

• 

  WB analysis using 12238-1-AP (same clone as 12238-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12238-1-AP (MKRN2 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12238-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 12238-1-AP (same clone as 12238-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 12238-1-AP (MKRN2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12238-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A375 using 12238-1-AP (same clone as 12238-1-PBS)

  A375 cells were subjected to SDS PAGE followed by western blot with 12238-1-AP (MKRN2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12238-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 12238-1-AP (same clone as 12238-1-PBS)

  IP result of anti-MKRN2 (IP:12238-1-AP, 4ug; Detection:12238-1-AP 1:2000) with HeLa cells lysate 1400 ug. This data was developed using the same antibody clone with 12238-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 12238-1-AP (same clone as 12238-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 12238-1-AP (MKRN2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12238-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 12238-1-AP (same clone as 12238-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 12238-1-AP (MKRN2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12238-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 12238-1-AP (same clone as 12238-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using MKRN2 antibody (12238-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 12238-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 12238-1-AP (same clone as 12238-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using MKRN2 antibody (12238-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 12238-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

MKRN2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 12238-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

E3 ubiquitin-protein ligase makorin-2, EC:2.3.2.27, HSPC070, makorin ring finger protein 2, RING finger protein 62

---

Product Information

12238-1-PBS targets MKRN2 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2881

  Product name: Recombinant human MKRN2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 67-416 aa of BC015715

  Sequence: GTMAHSVPSPAFHSPHPPSEVTASIVKTNSHEPGKREKRTLVLRDRNLSGMAERKTQPSMVSNPGSCSDPQPSPEMKPHSYLDAIRSGLDDVEASSSYSNEQQLCPYAAAGECRFGDACVYLHGEVCEICRLQVLHPFDPEQRKAHEKICMLTFEHEMEKAFAFQASQDKVCSICMEVILEKASASERRFGILSNCNHTYCLSCIRQWRCAKQFENPIIKSCPECRVISEFVIPSVYWVEDQNKKNELIEAFKQGMGKKACKYFEQGKGTCPFGSKCLYRHAYPDGRLAEPEKPRKQLSSQGTVRFFNSVRLWDFIENRESRHVPNNEDVDMTELGDLFMHLSGVESSEP

• Full Name: makorin ring finger protein 2
• Calculated Molecular Weight: 416 aa, 47 kDa
• Observed Molecular Weight: 47 kDa
• GenBank Accession Number: BC015715
• Gene Symbol: MKRN2
• Gene ID (NCBI): 23609
• RRID: AB_2142636
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H000
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MKRN2(Probable E3 ubiquitin-protein ligase makorin-2) is also named as RNF62. It is an E3 ubiquitin ligase that catalyzes the covalent attachment of ubiquitin moieties onto substrate proteins. It may be playing a functional role in negatively regulating neurogenesis via PI3K/Akt signaling.