CoraLite® Plus 488-conjugated MMAB Polyclonal antibody

MMAB Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-11137

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC, FC (Intra)

EC:2.5.1.-, Corrinoid adenosyltransferase MMAB, cblB, ATR, ATP:co(I)rrinoid adenosyltransferase MMAB

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-11137 targets MMAB in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1602

Product name: Recombinant human MMAB protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-250 aa of BC011831

Sequence: MAVCGLGSRLGLGSRLGLRGCFGAARLLYPRFQSRGPQGVEDGDRPQPSSKTPRIPKIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFALELVTEKGHTFAEELQKIQCTLQDVGSALATPCSSAREAHLKYTTFKAGPILELEQWIDKYTSQLPPLTAFILPSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEGNQEKIYMKNDPSAESEGL

Predict reactive species
Full Name methylmalonic aciduria (cobalamin deficiency) cblB type
Calculated Molecular Weight 27 kDa
Observed Molecular Weight 27 kDa
GenBank Accession NumberBC011831
Gene Symbol MMAB
Gene ID (NCBI) 326625
RRIDAB_3672483
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ96EY8
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

The MMAB gene encodes cob(I)alamin adenosyltransferase, which catalyzes the final step in the synthesis of the coenzyme adenosylcobalamin (AdoCbl). AdoCbl is a vitamin B12-containing coenzyme for methylmalonyl-CoA mutase. The deduced 250-amino acid protein has a calculated molecular mass of 27.3 kD.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 MMAB antibody CL488-11137Download protocol
FC protocol for CL Plus 488 MMAB antibody CL488-11137Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...