CoraLite® Plus 488-conjugated MME,CD10 Polyclonal antibody

MME,CD10 Polyclonal Antibody for
Cat No. CL488-10302

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

Atriopeptidase, CALLA, CD10, DKFZp686O16152, Enkephalinase, EPN, membrane metallo endopeptidase, MME, MME,CD10, NEP, Neprilysin, Neutral endopeptidase, Neutral endopeptidase 24.11

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

CL488-10302 targets MME,CD10 in applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0427

Product name: Recombinant human MME,CD10 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 52-252 aa of BC101658

Sequence: YDDGICKSSDCIKSAARLIQNMDATTEPCTDFFKYACGGWLKRNVIPETSSRYGNFDILRDELEVVLKDVLQEPKTEDIVAVQKAKALYRSCINESAIDSRGGEPLLKLLPDIYGWPVATENWEQKYGASWTAEKAIAQLNSKYGKKVLINLFVGTDDKNSVNHVIHIDQPRLGLPSRDYYECTGIYKEACTAYVDFMISV

Predict reactive species
Full Name membrane metallo-endopeptidase
Calculated Molecular Weight 750 aa, 86 kDa
Observed Molecular Weight 90-100 kDa
GenBank Accession NumberBC101658
Gene Symbol CD10
Gene ID (NCBI) 4311
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP08473
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

MME is also names as neprilysin,CALLA,NEP,SFE,CD10 and belongs to the peptidase M13 family.It is a glycoprotein that is particularly abundant in kidney, where it is present on the brush border of proximal tubules and on glomerular epithelium.CD10 has been considered a useful marker in the diagnosis of renal carcinomas, because of its expression in clear cell and papillary renal cell carcinomas and its absence in chromophobe renal cell carcinomas(PMID:15286660).

Loading...
||
New chat Able
正在加载,请稍候...