MMP13 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MMP13 Polyclonal antibody, PBS Only (18165-1-PBS)

• 

  WB analysis using 18165-1-AP (same clone as 18165-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 18165-1-AP (MMP13 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18165-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 18165-1-AP (same clone as 18165-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 18165-1-AP (MMP13 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18165-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 18165-1-AP (same clone as 18165-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 18165-1-AP (MMP13 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18165-1-PBS in a different storage buffer formulation.

• 

  IP experiment of MCF-7 using 18165-1-AP (same clone as 18165-1-PBS)

  IP result of anti-MMP13 (IP:18165-1-AP, 4ug; Detection:18165-1-AP 1:300) with MCF-7 cells lysate 2480 ug. This data was developed using the same antibody clone with 18165-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 18165-1-AP (same clone as 18165-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 18165-1-AP (MMP13 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18165-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 18165-1-AP (same clone as 18165-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 18165-1-AP (MMP13 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18165-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human hepatocirrhosis using 18165-1-AP (same clone as 18165-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis tissue slide using 18165-1-AP (MMP13 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18165-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human hepatocirrhosis using 18165-1-AP (same clone as 18165-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis tissue slide using 18165-1-AP (MMP13 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18165-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 18165-1-AP (same clone as 18165-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 18165-1-AP (MMP13 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18165-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 18165-1-AP (same clone as 18165-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 18165-1-AP (MMP13 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18165-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 18165-1-AP (same clone as 18165-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 18165-1-AP (MMP13 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18165-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 18165-1-AP (same clone as 18165-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 18165-1-AP (MMP13 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18165-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 18165-1-AP (same clone as 18165-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer using 18165-1-AP (MMP13 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 18165-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 18165-1-AP (same clone as 18165-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer using 18165-1-AP (MMP13 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 18165-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 18165-1-AP (same clone as 18165-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using MMP13 antibody (18165-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 18165-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

MMP13 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 18165-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

CLG3, Collagenase 3, EC:3.4.24.-, Matrix metalloproteinase 13, Matrix metalloproteinase-13

---

Product Information

18165-1-PBS targets MMP13 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12653

  Product name: Recombinant human MMP13 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 100-471 aa of BC074808

  Sequence: DVGEYNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC

• Full Name: matrix metallopeptidase 13
• Calculated Molecular Weight: 471 aa, 54 kDa
• Observed Molecular Weight: 65-70 kDa, 50-55 kDa, 40 kDa
• GenBank Accession Number: BC074808
• Gene Symbol: MMP13
• Gene ID (NCBI): 4322
• RRID: AB_2144858
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P45452
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MMP-13(Matrix metalloproteinase-13), cleaves type I collagen and was previously thought to be the rodent analogue of human interstitial MMP-1. MMP-13 is found in hypertrophic and calcifying cartilage of mammalian growth plate. The bands seen with rat MMP-13 are consistent with a 59-kDa latent form and a 43-kDa active form reported for this enzyme, along with a smaller band at approximately 30 kDa(PMID:10771523). It also can be detected 3 bands that the glycosylated proMMP-13 (70 kDa), unglycosylated proform (55 kDa), and active MMP-13 enzyme (40kDa) by western blot(PMID:18332263).