MMP23B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MMP23B Polyclonal antibody, PBS Only (13020-1-PBS)

• 

  WB analysis of A549 using 13020-1-AP (same clone as 13020-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 13020-1-AP (MMP23B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13020-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 13020-1-AP (same clone as 13020-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 13020-1-AP (MMP23B Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13020-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-3 using 13020-1-AP (same clone as 13020-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 13020-1-AP (MMP23B antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13020-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 13020-1-AP (same clone as 13020-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 13020-1-AP (MMP23B antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13020-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 13020-1-AP (same clone as 13020-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 13020-1-AP (MMP23B antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13020-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 13020-1-AP (same clone as 13020-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 13020-1-AP (MMP23B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13020-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 13020-1-AP (same clone as 13020-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 13020-1-AP (MMP23B Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13020-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 13020-1-AP (same clone as 13020-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 13020-1-AP (MMP23B Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13020-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 13020-1-AP (same clone as 13020-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 13020-1-AP (MMP23B Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13020-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 13020-1-AP (same clone as 13020-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 13020-1-AP (MMP23B Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13020-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 13020-1-AP (same clone as 13020-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using MMP23B antibody (13020-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red). This data was developed using the same antibody clone with 13020-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HepG2 using 13020-1-AP (same clone as 13020-1-PBS)

  1x10^6 HepG2 cells were intracellularly stained with 0.25 ug MMP23B Polyclonal antibody (13020-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 13020-1-PBS in a different storage buffer formulation.

MMP23B Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 13020-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

Synonyms

---

Product Information

13020-1-PBS targets MMP23B in applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4113

  Product name: Recombinant human MMP23B protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 52-390 aa of BC025719

  Sequence: QGDVAALGLSAVPPTRVPGPLAPRRRRYTLTPARLRWDHFNLTYRILSFPRNLLSPRETRRALAAAFRMWSDVSPFSFREVAPEQPSDLRIGFYPINHTDCLVSALHHCFDGPTGELAHAFFPPHGGIHFDDSEYWVLGPTRYSWKKGVWLTDLVHVAAHEIGHALGLMHSQHGRALMHLNATLRGWKALSQDELWGLHRLYGCLDRLFVCASWARRGFCDARRRLMKRLCPSSCDFCYEFPFPTVATTPPPPRTKTRLVPEGRNVTFRCGQKILHKKGKVYWYKDQEPLEFSYPGYLALGEAHLSIIANAVNEGTYTCVVRRQQRVLTTYSWRVRVRG

• Full Name: matrix metallopeptidase 23B
• Calculated Molecular Weight: 390 aa, 44 kDa
• Observed Molecular Weight: 46-60 kDa
• GenBank Accession Number: BC025719
• Gene Symbol: MMP23B
• Gene ID (NCBI): 8510
• RRID: AB_2146152
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75900
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MMP23B(matrix metallopeptidase 23B) is also named as MMP21, MMP22.It is a regulator in matrix remodeling and may be playing a role in enchondral bone formation and in regulation of cranial suture closure .It has 3 isoforms produced by alternative splicing with the molecular weight of 44KDa,48KDa and 46KDa,respectively.It also can be N-glycosylated.