MMP28 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MMP28 Polyclonal antibody, PBS Only (18237-1-PBS)

• 

  WB analysis of A549 using 18237-1-AP (same clone as 18237-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 18237-1-AP (MMP28 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18237-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse heart using 18237-1-AP (same clone as 18237-1-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 18237-1-AP (MMP28 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18237-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human colon using 18237-1-AP (same clone as 18237-1-PBS)

  human colon tissue were subjected to SDS PAGE followed by western blot with 18237-1-AP (MMP28 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18237-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 18237-1-AP (same clone as 18237-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 18237-1-AP (MMP28 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 18237-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 18237-1-AP (same clone as 18237-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 18237-1-AP (MMP28 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 18237-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 18237-1-AP (same clone as 18237-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 18237-1-AP (MMP28 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 18237-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 18237-1-AP (same clone as 18237-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 18237-1-AP (MMP28 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 18237-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary using 18237-1-AP (same clone as 18237-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary using 18237-1-AP (MMP28 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 18237-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary using 18237-1-AP (same clone as 18237-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary using 18237-1-AP (MMP28 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 18237-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 18237-1-AP (same clone as 18237-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 18237-1-AP (MMP28 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 18237-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 18237-1-AP (same clone as 18237-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 18237-1-AP (MMP28 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 18237-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin cancer using 18237-1-AP (same clone as 18237-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 18237-1-AP (MMP28 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 18237-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin cancer using 18237-1-AP (same clone as 18237-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 18237-1-AP (MMP28 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 18237-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A549 using 18237-1-AP (same clone as 18237-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using MMP28 antibody (18237-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 18237-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

MMP28 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 18237-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

MM28, Matrix metalloproteinase-28, Matrix metalloproteinase 28, matrix metallopeptidase 28, Epilysin

---

Product Information

18237-1-PBS targets MMP28 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12980

  Product name: Recombinant human MMP28 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 194-393 aa of BC002631

  Sequence: LGNAFDGPGGALAHAFLPRRGEAHFDQDERWSLSRRRGRNLFVVLAHEIGHTLGLTHSPAPRALMAPYYKRLGRDALLSWDDVLAVQSLYGKPLGGSVAVQLPGKLFTDFETWDSYSPQGRRPETQGPKYCHSSFDAITVDRQQQLYIFKGSHFWEVAADGNVSEPRPLQERWVGLPPNIEAAAVSLNDGDFYFFKVQSV

• Full Name: matrix metallopeptidase 28
• Calculated Molecular Weight: 59 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC002631
• Gene Symbol: MMP28
• Gene ID (NCBI): 79148
• RRID: AB_2146444
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H239
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MMP28(Epilysin)can degrade casein and play a role in tissues homeostasis and repair .The only specific human cell type recognized to express epilysin is the basal keratinocyte in the skin, where epilysin expression is upregulated during wound repair(PMID:16940349).Western blot showed this antibody recognize bands at 62 and 58 kDa as well as breakdown products at 50, 48, and 46 kDa(PMID:15953044).This antibody is specific to MMP28.