MPHOSPH9 Recombinant monoclonal antibody

MPHOSPH9 Uni-rAb® Recombinant Antibody for WB, FC (Intra), ELISA
Cat No. 83397-5-RR
Clone No.240182D6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, FC (Intra), ELISA

240182D6, M-phase phosphoprotein 9, MPP 9, MPP9

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, rat brain tissue, NIH/3T3 cells, PC-12 cells, SH-SY5Y cells, mouse brain tissue
Positive FC (Intra) detected inA431 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83397-5-RR targets MPHOSPH9 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag22228

Product name: Recombinant human MPHOSPH9 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 5-350 aa of BC130440

Sequence: SLSSERNESVIHYPESTEPEIQQEMSTSQPDCNVDSCSVSSGYGTFCISELNLYKSKDPKEFMEHIDVPKGQYVAPAVPAESLVDGVKNENFYIQTPEECHVSLKEDVSISPGEFEHNFLGENKVSEVYSGKTNSNAITSWAQKLKQNQPKRAHVEDGGSRSKQGNEQSKKTPIEKSDFAAATHPRAFYLSKPDETPNAWMSDSGTGLTYWKLEEKDMHHSLPETLEKTFISLSSTDVSPNQSNTSNEMKLPSLKDIYYKKQRENKQLPERNLTSASNPNHPPEVLTLDPTLHMKPKQQISGIQPHGLPNALDDRISFSPDSVLEPSMSSPSDIDSFSQASNVTSQ

Predict reactive species
Full Name M-phase phosphoprotein 9
Calculated Molecular Weight 1031 aa, 116 kDa
Observed Molecular Weight 116 kDa
GenBank Accession NumberBC130440
Gene Symbol MPHOSPH9
Gene ID (NCBI) 10198
RRIDAB_3671049
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ99550
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MPHOSPH9, also known as MPP9, is a protein phosphorylated during mitosis. MPHOSPH9 negatively regulates cilia formation by recruiting the CP110-CEP97 complex at the distal end of the mother centriole in ciliary cells. MPHOSPH9 is a centrosome component that localizes to the distal and proximal ends of two centrioles(PMID: 30375385).

Protocols

Product Specific Protocols
FC protocol for MPHOSPH9 antibody 83397-5-RRDownload protocol
WB protocol for MPHOSPH9 antibody 83397-5-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...