MPI Monoclonal antibody, PBS Only

• 

  WB analysis using 68417-1-Ig (same clone as 68417-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68417-1-Ig (MPI antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 68417-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 68417-1-Ig (same clone as 68417-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 68417-1-Ig (MPI antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68417-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 68417-1-Ig (same clone as 68417-1-PBS)

  WB result of MPI antibody (68417-1-Ig; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-MPI transfected HEK-293 cells. This data was developed using the same antibody clone with 68417-1-PBS in a different storage buffer formulation.

• 

  IP experiment of Jurkat using 68417-1-Ig (same clone as 68417-1-PBS)

  IP result of anti-MPI (IP:68417-1-Ig, 4ug; Detection:68417-1-Ig 1:2000) with Jurkat cells lysate 2280 ug. This data was developed using the same antibody clone with 68417-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 68417-1-Ig (same clone as 68417-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 68417-1-Ig (MPI antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68417-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 68417-1-Ig (same clone as 68417-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 68417-1-Ig (MPI antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68417-1-PBS in a different storage buffer formulation.

• 

  IF Staining of NIH/3T3 using 68417-1-Ig (same clone as 68417-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed NIH/3T3 cells using MPI antibody (68417-1-Ig, Clone: 3B10A6 ) at dilution of 1:1000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 68417-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

MPI Monoclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 68417-1-PBS

Clone No.3B10A6

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

Phosphomannose isomerase, Phosphohexomutase, Mannose-6-phosphate isomerase, mannose phosphate isomerase, Mannose 6 phosphate isomerase

---

Product Information

68417-1-PBS targets MPI in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5475

  Product name: Recombinant human MPI protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-423 aa of BC046357

  Sequence: MAAPRVFPLSCAVQQYAWGKMGSNSEVARLLASSDPLAQIAEDKPYAELWMGTHPRGDAKILDNRISQKTLSQWIAENQDSLGSKVKDTFNGNLPFLFKVLSVETPLSIQAHPNKELAEKLHLQAPQHYPDANHKPEMAIALTPFQGLCGFRPVEEIVTFLKKVPEFQFLIGDEAATHLKQTMSHDSQAVASSLQSCFSHLMKSEKKVVVEQLNLLVKRISQQAAAGNNMEDIFGELLLQLHQQYPGDIGCFAIYFLNLLTLKPGEAMFLEANVPHAYLKGDCVECMACSDNTVRAGLTPKFIDVPTLCEMLSYTPSSSKDRLFLPTRSQEDPYLSIYDPPVPDFTIMKTEVPGSVTEYKVLALDSASILLMVQGTVIASTPTTQTPIPLQRGGVLFIGANESVSLKLTEPKDLLIFRACCLL

• Full Name: mannose phosphate isomerase
• Calculated Molecular Weight: 47 kDa
• Observed Molecular Weight: 40-47 kDa
• GenBank Accession Number: BC046357
• Gene Symbol: MPI
• Gene ID (NCBI): 4351
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P34949
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MPI(mannose-6-phosphate isomerase) is also named as PMI1 and belongs to the mannose-6-phosphate isomerase type 1 family. It is a zinc metalloenzyme that catalyzes the reversible isomerization of mannose-6-phosphate and fructose-6-phosphate. MPI plays a critical role in maintaining the supply of D-mannose derivatives, which are required for most glycosylation reactions. This proterin has 2 isoforms produced by alternative splicing.