• Featured Product
  • KD/KO Validated

MPO Monoclonal antibody, PBS Only

MPO Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, FC (Intra), Indirect ELISA
Cat No. 66177-1-PBS
Clone No.4C11F6

Host / Isotype

Mouse / IgA

Reactivity

human, rat

Applications

WB, IHC, IF/ICC, IF-P, FC (Intra), Indirect ELISA

4C11F6, EC:1.11.2.2, myeloperoxidase

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Not recommend for IHC about rat sample. Mouse monoclonal antibodies of IgA isotype can be detected with "anti-mouse IgG (H+L)" secondary antibodies.

Product Information

66177-1-PBS targets MPO in WB, IHC, IF/ICC, IF-P, FC (Intra), Indirect ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Mouse / IgA
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17564

Product name: Recombinant human MPO protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 606-657 aa of BC130476

Sequence: CGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRV

Predict reactive species
Full Name myeloperoxidase
Calculated Molecular Weight 745 aa, 84 kDa
Observed Molecular Weight 90 kDa
GenBank Accession NumberBC130476
Gene Symbol MPO
Gene ID (NCBI) 4353
RRIDAB_2881572
Conjugate Unconjugated
FormLiquid
Purification MethodCaprylic acid/ammonium sulfate precipitation
UNIPROT IDP05164
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

The MPO gene encodes myeloperoxidase, a lysosomal hemoprotein located in the azurophilic granules of polymorphonuclear (PMN) leukocytes and monocytes. In response to stimulation, MPO is activated into a transient intermediate with potent antimicrobial oxidizing abilities(PMID:17650507). The mRNA is translated into a single protein of 90 kDa, which displays enzymatic activity and undergoes proteolytic maturation into a heavy chain of 59 kDa and a light chain of 13.5 kDa; these subunits then dimerize into the mature tetramer and the mature MPO is a heterotetramer composed of two identical heavy chains and two identical light chains(PMID:12773517). Fragments with molecular masses of 43-47 kDa were formed by autocatalysis during warming in sample buffer (PMID:12960244). The 24-kDa material had a map identical to that of 13.5 kDa subunit and represents a dimer of the 13.5 kDa subunit (PMID:3008892). Defects in MPO are the cause of myeloperoxidase deficiency (MPOD). It has 3 isoforms produced by alternative splicing.

Loading...
||
New chat Able
正在加载,请稍候...