MPO Monoclonal antibody, PBS Only

• 

  WB analysis of HL-60 using 66177-1-Ig (same clone as 66177-1-PBS)

  HL-60 cells were subjected to SDS PAGE followed by western blot with 66177-1-Ig (MPO antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66177-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 66177-1-Ig (same clone as 66177-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66177-1-Ig (MPO antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66177-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 66177-1-Ig (same clone as 66177-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66177-1-Ig (MPO antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66177-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 66177-1-Ig (same clone as 66177-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66177-1-Ig (MPO antibody) at dilution of 1:5000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66177-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 66177-1-Ig (same clone as 66177-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66177-1-Ig (MPO antibody) at dilution of 1:8000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66177-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 66177-1-Ig (same clone as 66177-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66177-1-Ig (MPO antibody) at dilution of 1:8000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66177-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human appendicitis using 66177-1-Ig (same clone as 66177-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human appendicitis tissue using MPO antibody (66177-1-Ig, Clone: 4C11F6 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66177-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HL-60 using 66177-1-Ig (same clone as 66177-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HL-60 cells using MPO antibody (66177-1-Ig, Clone: 4C11F6 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 66177-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HL-60 using 66177-1-Ig (same clone as 66177-1-PBS)

  1x10^6 HL-60 cells were intracellularly stained with 0.25 ug MPO Monoclonal antibody (66177-1-Ig, Clone:4C11F6) and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 66177-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

MPO Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, FC (Intra), Indirect ELISA

Cat No. 66177-1-PBS

Clone No.4C11F6

Host / Isotype

Mouse / IgA

Reactivity

human, rat

Applications

WB, IHC, IF/ICC, IF-P, FC (Intra), Indirect ELISA

Synonyms

4C11F6, EC:1.11.2.2, myeloperoxidase

---

Not recommend for IHC about rat sample. Mouse monoclonal antibodies of IgA isotype can be detected with "anti-mouse IgG (H+L)" secondary antibodies.

Product Information

66177-1-PBS targets MPO in WB, IHC, IF/ICC, IF-P, FC (Intra), Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Mouse / IgA
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17564

  Product name: Recombinant human MPO protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 606-657 aa of BC130476

  Sequence: CGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRV

• Full Name: myeloperoxidase
• Calculated Molecular Weight: 745 aa, 84 kDa
• Observed Molecular Weight: 90 kDa
• GenBank Accession Number: BC130476
• Gene Symbol: MPO
• Gene ID (NCBI): 4353
• RRID: AB_2881572
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Caprylic acid/ammonium sulfate precipitation
• UNIPROT ID: P05164
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The MPO gene encodes myeloperoxidase, a lysosomal hemoprotein located in the azurophilic granules of polymorphonuclear (PMN) leukocytes and monocytes. In response to stimulation, MPO is activated into a transient intermediate with potent antimicrobial oxidizing abilities(PMID:17650507). The mRNA is translated into a single protein of 90 kDa, which displays enzymatic activity and undergoes proteolytic maturation into a heavy chain of 59 kDa and a light chain of 13.5 kDa; these subunits then dimerize into the mature tetramer and the mature MPO is a heterotetramer composed of two identical heavy chains and two identical light chains(PMID:12773517). Fragments with molecular masses of 43-47 kDa were formed by autocatalysis during warming in sample buffer (PMID:12960244). The 24-kDa material had a map identical to that of 13.5 kDa subunit and represents a dimer of the 13.5 kDa subunit (PMID:3008892). Defects in MPO are the cause of myeloperoxidase deficiency (MPOD). It has 3 isoforms produced by alternative splicing.