Tested Applications
| Positive WB detected in | HL-60 cells |
| Positive IHC detected in | human liver tissue, human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human tonsillitis tissue |
| Positive IF/ICC detected in | HL-60 cells |
| Positive FC (Intra) detected in | HL-60 cells |
Mouse monoclonal antibodies of IgA isotype can be detected with "anti-mouse IgG (H+L)" secondary antibodies.
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunohistochemistry (IHC) | IHC : 1:400-1:1600 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66177-1-Ig targets MPO in WB, IHC, IF/ICC, IF-P, FC (Intra), IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, rat, bovine, cow |
| Host / Isotype | Mouse / IgA |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17564 Product name: Recombinant human MPO protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 606-657 aa of BC130476 Sequence: CGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRV Predict reactive species |
| Full Name | myeloperoxidase |
| Calculated Molecular Weight | 745 aa, 84 kDa |
| Observed Molecular Weight | 90 kDa |
| GenBank Accession Number | BC130476 |
| Gene Symbol | MPO |
| Gene ID (NCBI) | 4353 |
| RRID | AB_2881572 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Thiophilic affinity chromatograph |
| UNIPROT ID | P05164 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The MPO gene encodes myeloperoxidase, a lysosomal hemoprotein located in the azurophilic granules of polymorphonuclear (PMN) leukocytes and monocytes. In response to stimulation, MPO is activated into a transient intermediate with potent antimicrobial oxidizing abilities(PMID:17650507). The mRNA is translated into a single protein of 90 kDa, which displays enzymatic activity and undergoes proteolytic maturation into a heavy chain of 59 kDa and a light chain of 13.5 kDa; these subunits then dimerize into the mature tetramer and the mature MPO is a heterotetramer composed of two identical heavy chains and two identical light chains(PMID:12773517). Fragments with molecular masses of 43-47 kDa were formed by autocatalysis during warming in sample buffer (PMID:12960244). The 24-kDa material had a map identical to that of 13.5 kDa subunit and represents a dimer of the 13.5 kDa subunit (PMID:3008892). Defects in MPO are the cause of myeloperoxidase deficiency (MPOD). It has 3 isoforms produced by alternative splicing.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for MPO antibody 66177-1-Ig | Download protocol |
| IF protocol for MPO antibody 66177-1-Ig | Download protocol |
| IHC protocol for MPO antibody 66177-1-Ig | Download protocol |
| WB protocol for MPO antibody 66177-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-Myeloperoxidase (MPO) antibody (Cat# 66177-1-Ig) has 106 citations published in journals such as Cell, Nature Communications, Neuron, Advanced Science, Oncogene, Cell Reports, International Journal of Molecular Sciences, and Frontiers in Immunology. Associated research fields include neutrophil extracellular trap (NET) biology, inflammation, cancer, wound healing, liver and lung injury, cardiovascular disease, autoimmune disorders, and infectious disease.
| Species | Application | Title |
|---|---|---|
Cell Neutrophil trapping and nexocytosis, mast cell-mediated processes for inflammatory signal relay | ||
Adv Mater Tracing Immunological Interaction in Trimethylamine N-Oxide Hydrogel-Derived Zwitterionic Microenvironment During Promoted Diabetic Wound Regeneration | ||
Cancer Commun (Lond) Elevated neutrophil extracellular traps by HBV-mediated S100A9-TLR4/RAGE-ROS cascade facilitate the growth and metastasis of hepatocellular carcinoma | ||
Bioact Mater Nanozyme-crosslinked dual-network hydrogel enables multi-stage modulation of the dysregulated repair cascade for regenerative wound healing. | ||
Nat Commun Ultrasound-responsive theranostic platform for the timely monitoring and efficient thrombolysis in thrombi of tPA resistance | ||
Nat Commun S100A12 triggers NETosis to aggravate myocardial infarction injury via the Annexin A5-calcium axis |
