Use Able AI chat for product recommendations

MPZ / P0 Polyclonal antibody, PBS Only

MPZ / P0 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 10572-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

MPZ, Myelin protein zero, CHM, MPP, Myelin peripheral protein

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

10572-1-PBS targets MPZ / P0 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0848

Product name: Recombinant human MPZ,P0 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-258 aa of BC006491

Sequence: MLRAPAPAPAMAPGAPSSSPSPILAVLLFSSLVLSPAQAIVVYTDREVHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRYGVVLGAVIGGVLGVVLLLLLLFYVVRYCWLRRQAALQRRLSAMEKGKLHKPGKDASKRGRQTPVLYAMLDHSRSTKAVSEKKAKGLGESRKDKK

Predict reactive species
Full Name myelin protein zero
Calculated Molecular Weight 28 kDa
Observed Molecular Weight 28-30 kDa
GenBank Accession NumberBC006491
Gene Symbol MPZ
Gene ID (NCBI) 4359
RRIDAB_2144657
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP25189
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

MPZ (myelin protein zero), also known as P0, is a transmembrane glycoprotein that belongs to the immunoglobulin supergene family. Synthesized by myelin-forming Schwann cells, MPZ is the major structural protein component of myelin in the peripheral nervous system. It is involved in the formation and maintenance of compact myelin and plays a role in the creation of an extracellular membrane face which guides the wrapping process and ultimately compacts adjacent lamellae. More than 120 mutations detected in the gene of MPZ cause various forms of hereditary neuropathy, which include Charcot-Marie-Tooth disease type 1B (CMT1B), CMT2, Dejerine-Sottas syndrome (DSS), and congenital hypomyelination neuropathy (CHN). This antibody can recognize endogenous MPZ and can be used as a marker of myelinating Schwann cells. MPZ can be detected the 25-30 kDa band by western blot. A band of 36 kDa could also be detected, which is a novel isoform of MPZ that contains an additional domain at the C-terminal (PMID: 22457349). It can also exist as a dimer (PMID: 12933931).

Loading...
||
New chat

Able

正在加载,请稍候...