CoraLite® Plus 488-conjugated MRP1 Monoclonal antibody

• 

  IF Staining of A549 using CL488-67228

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using CoraLite® Plus 488 MRP1 antibody (CL488-67228, Clone: 1G4A2 ) at dilution of 1:200.

MRP1 Monoclonal Antibody for IF/ICC

Cat No. CL488-67228

Clone No.1G4A2

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IF/ICC

Synonyms

ABCC1, 1G4A2

---

Tested Applications

• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67228 targets MRP1 in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27048

  Product name: Recombinant human ABCC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 918-1025 aa of NM_004996

  Sequence: SSYSGDISRHHNSTAELQKAEAKKEETWKLMEADKAQTGQVKLSVYWDYMKAIGLFISFLSIFLFMCNHVSALASNYWLSLWTDDPIVNGTQEHTKVRLSVYGALGIS

• Full Name: ATP-binding cassette, sub-family C (CFTR/MRP), member 1
• Calculated Molecular Weight: 172 kDa
• Observed Molecular Weight: 180-190 kDa
• GenBank Accession Number: NM_004996
• Gene Symbol: MRP1
• Gene ID (NCBI): 4363
• RRID: AB_3672942
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P33527
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Multidrug resistant-associated protein 1 (MRP1; ABCC1) is a member of the ATP-binding cassette (ABC) transporter protein superfamily, subfamily C. MRP1 is overexpressed in cancers and contributes to the occurrence of multidrug resistance (MDR). Expression of MRP1 has been considered as a negative marker for the outcome of chemotherapy. Recently MRP1 has been reported to play a crucial role in Aβ clearance at the blood-brain barrier.