MRP4 Monoclonal antibody, PBS Only

• 

  WB analysis using 67230-1-Ig (same clone as 67230-1-PBS)

  Non-boil and boiled HepG2, A549, and PC-12 cell lysates were subjected to SDS PAGE followed by western blot with 67230-1-Ig (ABCC4 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67230-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate hyperplasia using 67230-1-Ig (same clone as 67230-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate hyperplasia tissue slide using 67230-1-Ig (ABCC4 antibody) at dilution of 1:1000 (under 40x lens).. This data was developed using the same antibody clone with 67230-1-PBS in a different storage buffer formulation.

MRP4 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 67230-1-PBS

Clone No.1B10B4

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

ABCC4, 1B10B4, ATP-binding cassette sub-family C member 4, EC:7.6.2.-, MOATB

---

Product Information

67230-1-PBS targets MRP4 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10171

  Product name: Recombinant human ABCC4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 347-707 aa of BC041560

  Sequence: TASRVFVAVTLYGAVRLTVTLFFPSAIERVSEAIVSIRRIQTFLLLDEISQRNRQLPSDGKKMVHVQDFTAFWDKASETPTLQGLSFTVRPGELLAVVGPVGAGKSSLLSAVLGELAPSHGLVSVHGRIAYVSQQPWVFSGTLRSNILFGKKYEKERYEKVIKACALKKDLQLLEDGDLTVIGDRGTTLSGGQKARVNLARAVYQDADIYLLDDPLSAVDAEVSRHLFELCICQILHEKITILVTHQLQYLKAASQILILKDGKMVQKGTYTEFLKSGIDFGSLLKKDNEESEQPPVPGTPTLRNRTFSESSVWSQQSSRPSLKDGALESQDTENVPVTLSEENRSEGKVGFQAYKNYFRA

• Full Name: ATP-binding cassette, sub-family C (CFTR/MRP), member 4
• Calculated Molecular Weight: 859 aa, 97 kDa
• Observed Molecular Weight: 160-180 kDa
• GenBank Accession Number: BC041560
• Gene Symbol: MRP4
• Gene ID (NCBI): 10257
• RRID: AB_2882517
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O15439
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MRP4 (also known as ABCC4), belonging to ATP-binding cassette (ABC) transporter family, is a multi-transmembrane protein that is able to transport a range of organic anionic compounds (both endogenous and xenobiotic) out of the cell. It can exclude various drugs thus is considered as potential target to prevent drug-resistance.