MRPL20 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MRPL20 Polyclonal antibody, PBS Only (16969-1-PBS)

• 

  WB analysis using 16969-1-AP (same clone as 16969-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 16969-1-AP (MRPL20 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16969-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 16969-1-AP (same clone as 16969-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 16969-1-AP (MRPL20 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16969-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 16969-1-AP (same clone as 16969-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using MRPL20 antibody (16969-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red). This data was developed using the same antibody clone with 16969-1-PBS in a different storage buffer formulation.

MRPL20 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 16969-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

L20mt, Large ribosomal subunit protein bL20m, MRP L20, MRP-L20

---

Product Information

16969-1-PBS targets MRPL20 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9160

  Product name: Recombinant human MRPL20 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-149 aa of BC009515

  Sequence: MVFLTAQLWLRNRVTDRYFRIQEVLKHARHFRGRKNRCYRLAVRTVIRAFVKCTKARYLKKKNMRTLWINRITAASQEHGLKYPALIGNLVKCQVELNRKVLADLAIYEPKTFKSLAALASRRRHEGFAAALGDGKEPEGIFSRVVQYH

• Full Name: mitochondrial ribosomal protein L20
• Calculated Molecular Weight: 149 aa, 17 kDa
• Observed Molecular Weight: 17 kDa
• GenBank Accession Number: BC009515
• Gene Symbol: MRPL20
• Gene ID (NCBI): 55052
• RRID: AB_3741901
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BYC9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MRPL20 (mitochondrial ribosomal protein L20) is a 149-amino-acid nuclear-encoded protein that belongs to the bacterial ribosomal protein bL20 family. As a structural constituent of the mitochondrial ribosome , MRPL20 localizes to the 39S large subunit, where it integrates into the mitochondrial inner membrane and facilitates the synthesis of mitochondrial genome-encoded proteins-including essential transmembrane subunits of the mitochondrial respiratory chain-by participating in all three phases of mitochondrial translation: initiation, elongation, and termination.