MRPL24 Monoclonal antibody

• 

  WB analysis of HeLa using 68556-1-Ig

  WB result of MRPL24 antibody (68556-1-Ig; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-MRPL24 transfected HeLa cells.

• 

  WB analysis using 68556-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68556-1-Ig (MRPL24 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

MRPL24 Monoclonal Antibody for WB, ELISA

Cat No. 68556-1-Ig

Clone No.3D3C8

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, ELISA

Synonyms

MRP-L24, MRP L24, MRP L18, Large ribosomal subunit protein uL24m, L24mt

---

Tested Applications

• Positive WB detected in: HepG2 cells, HeLa cells, A431 cells, HT-29 cells, LNCaP cells, HEK-293 cells, Jurkat cells, K-562 cells, Raji cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

68556-1-Ig targets MRPL24 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9576

  Product name: Recombinant human MRPL24 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-216 aa of BC016700

  Sequence: MRLSALLALASKVTLPPHYRYGMSPPGSVADKRKNPPWIRRRPVVVEPISDEDWYLFCGDTVEILEGKDAGKQGKVVQVIRQRNWVVVGGLNTHYRYIGKTMDYRGTMIPSEAPLLHRQVKLVDPMDRKPTEIEWRFTEAGERVRVSTRSGRIIPKPEFPRADGIVPETWIDGPKDTSVEDALERTYVPCLKTLQEEVMEAMGIKETRKYKKVYWY

• Full Name: mitochondrial ribosomal protein L24
• Calculated Molecular Weight: 216 aa, 25 kDa
• Observed Molecular Weight: 25-28 kDa
• GenBank Accession Number: BC016700
• Gene Symbol: MRPL24
• Gene ID (NCBI): 79590
• RRID: AB_3085259
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q96A35
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.