MRPL24 Monoclonal antibody, PBS Only

• 

  WB analysis of HeLa using 68556-1-Ig (same clone as 68556-1-PBS)

  WB result of MRPL24 antibody (68556-1-Ig; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-MRPL24 transfected HeLa cells. This data was developed using the same antibody clone with 68556-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 68556-1-Ig (same clone as 68556-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68556-1-Ig (MRPL24 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68556-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

MRPL24 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 68556-1-PBS

Clone No.3D3C8

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

MRP-L24, MRP L24, MRP L18, Large ribosomal subunit protein uL24m, L24mt

---

Product Information

68556-1-PBS targets MRPL24 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9576

  Product name: Recombinant human MRPL24 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-216 aa of BC016700

  Sequence: MRLSALLALASKVTLPPHYRYGMSPPGSVADKRKNPPWIRRRPVVVEPISDEDWYLFCGDTVEILEGKDAGKQGKVVQVIRQRNWVVVGGLNTHYRYIGKTMDYRGTMIPSEAPLLHRQVKLVDPMDRKPTEIEWRFTEAGERVRVSTRSGRIIPKPEFPRADGIVPETWIDGPKDTSVEDALERTYVPCLKTLQEEVMEAMGIKETRKYKKVYWY

• Full Name: mitochondrial ribosomal protein L24
• Calculated Molecular Weight: 216 aa, 25 kDa
• Observed Molecular Weight: 25-28 kDa
• GenBank Accession Number: BC016700
• Gene Symbol: MRPL24
• Gene ID (NCBI): 79590
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q96A35
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.