MSTN Recombinant monoclonal antibody, PBS Only (Detector)

• 

  Sandwich ELISA sample test of MP02424-1

  Plasma of six individual healthy human donors was measured. The GDF8/Myostatin concentration of detected samples was determined to be 15.87 ng/mL with a range of 9.27-22.32 ng/mL.

• 

  Sandwich ELISA standard curve of MP02424-1

  Sandwich ELISA standard curve of MP02424-1, Human GDF8/Myostatin Recombinant Matched Antibody Pair - PBS only. 86408-1-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg1972. 86408-2-PBS was HRP conjugated as the detection antibody. Range: 0.156-10 ng/mL.

• 

  Cytometric bead array sample test of MP02424-1

  The mean GDF8/Myostatin concentration was determined to be 32.1 ng/mL in human serum.

• 

  Cytometric bead array standard curve of MP02424-1

  Cytometric bead array standard curve of MP02424-1, GDF8/Myostatin Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 86408-1-PBS. Detection antibody: 86408-2-PBS. Standard: Eg1972. Range: 3.125-200 ng/mL.

MSTN Uni-rAb^® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA

Cat No. 86408-2-PBS

Clone No.250547D4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA

Synonyms

GDF8, GDF8/Myostatin, myostatin, GDF 8, GDF-8

---

Product Information

86408-2-PBS targets MSTN as part of a matched antibody pair:

MP02424-1: 86408-1-PBS capture and 86408-2-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1972

  Product name: recombinant human MSTN protein

  Source: mammalian cells-derived, pHZ-KIsec-N-rFc

  Tag: N-rFc

  Domain: 24-375 aa of BC074757

  Sequence: NENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS

• Full Name: myostatin
• Calculated Molecular Weight: 375 aa, 43 kDa
• GenBank Accession Number: BC074757
• Gene Symbol: MSTN
• Gene ID (NCBI): 2660
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O14793
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.