MTAP Monoclonal antibody

• 

  WB analysis of NIH/3T3 using 66706-1-Ig

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 66706-1-Ig (MTAP antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Raji using 66706-1-Ig

  Raji cells were subjected to SDS PAGE followed by western blot with 66706-1-Ig (MTAP antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HT-29 using 66706-1-Ig

  HT-29 cells were subjected to SDS PAGE followed by western blot with 66706-1-Ig (MTAP antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HCT 116 using 66706-1-Ig

  HCT 116 cells were subjected to SDS PAGE followed by western blot with 66706-1-Ig (MTAP antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HSC-T6 using 66706-1-Ig

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 66706-1-Ig (MTAP antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse liver using 66706-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 66706-1-Ig (MTAP antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 66706-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 66706-1-Ig (MTAP antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 66706-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 66706-1-Ig (MTAP antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 66706-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 66706-1-Ig (MTAP antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat liver using 66706-1-Ig

  Immunohistochemical analysis of paraffin-embedded rat liver tissue slide using 66706-1-Ig (MTAP antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat liver using 66706-1-Ig

  Immunohistochemical analysis of paraffin-embedded rat liver tissue slide using 66706-1-Ig (MTAP antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 66706-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66706-1-Ig (MTAP antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 66706-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66706-1-Ig (MTAP antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 66706-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66706-1-Ig (MTAP antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 66706-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66706-1-Ig (MTAP antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 66706-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66706-1-Ig (MTAP antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 66706-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66706-1-Ig (MTAP antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 66706-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66706-1-Ig (MTAP antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 66706-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66706-1-Ig (MTAP antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 66706-1-Ig

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 66706-1-Ig (MTAP antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 66706-1-Ig

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 66706-1-Ig (MTAP antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 66706-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using MTAP antibody (66706-1-Ig, Clone: 2B1G6 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red).

MTAP Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66706-1-Ig

Clone No.2B1G6

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

2B1G6, 5'-methylthioadenosine phosphorylase, c86fus, EC:2.4.2.28, MSAP

---

Tested Applications

• Positive WB detected in: NIH/3T3 cells, HCT 116 cells, HSC-T6 cells, Raji cells, HT-29 cells
• Positive IHC detected in: mouse liver tissue, human kidney tissue, rat liver tissue, mouse kidney tissue, human colon cancer tissue, human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66706-1-Ig targets MTAP in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17954

  Product name: Recombinant human MTAP protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-154 aa of BC018625

  Sequence: MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCILLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDSHVRRACFPFTFHHDCFQRPPQKPSRSHCVSCATCRTMS

• Full Name: methylthioadenosine phosphorylase
• Calculated Molecular Weight: 283 aa, 31 kDa
• Observed Molecular Weight: 31 kDa
• GenBank Accession Number: BC018625
• Gene Symbol: MTAP
• Gene ID (NCBI): 4507
• RRID: AB_2882058
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q13126
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MTAP is a 5-deoxy-5-methylthioadenosine (MTA) phosphorylase, converting MTA to salvageable intermediates including adenine and 5-methylthioribose-1-phosphate. MTAP is abundant in normal cells, but it is frequently found to be deleted in a variety of cancers. Its deficiency is common in cancer cell lines as well as in primary leukemia, lung cancer, melanoma, bladder cancer, gliomas and breast cancer.