CoraLite®594-conjugated MTAP Monoclonal antibody

• 

  IF Staining of HeLa using CL594-66706

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using CL594-66706 (MTAP antibody) at dilution of 1:100.

MTAP Monoclonal Antibody for IF/ICC

Cat No. CL594-66706

Clone No.2B1G6

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse, Rat

Applications

IF/ICC

Synonyms

c86fus, MSAP, MTA phosphorylase, MTAP, MTAPase

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66706 targets MTAP in IF/ICC applications and shows reactivity with Human, Mouse, Rat samples.

• Tested Reactivity: Human, Mouse, Rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17954

  Product name: Recombinant human MTAP protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-154 aa of BC018625

  Sequence: MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCILLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDSHVRRACFPFTFHHDCFQRPPQKPSRSHCVSCATCRTMS

• Full Name: methylthioadenosine phosphorylase
• Calculated Molecular Weight: 283 aa, 31 kDa
• Observed Molecular Weight: 31 kDa
• GenBank Accession Number: BC018625
• Gene Symbol: MTAP
• Gene ID (NCBI): 4507
• RRID: AB_2883617
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q13126
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

MTAP is a 5-deoxy-5-methylthioadenosine (MTA) phosphorylase, converting MTA to salvageable intermediates including adenine and 5-methylthioribose-1-phosphate. MTAP is abundant in normal cells, but it is frequently found to be deleted in a variety of cancers. Its deficiency is common in cancer cell lines as well as in primary leukemia, lung cancer, melanoma, bladder cancer, gliomas and breast cancer.