MTH1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MTH1 Polyclonal antibody, PBS Only (16705-1-PBS)

• 

  WB analysis of Jurkat using 16705-1-AP (same clone as 16705-1-PBS)

  WB result of MTH1 antibody (16705-1-AP; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-MTH1 transfected Jurkat cells. This data was developed using the same antibody clone with 16705-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 16705-1-AP (same clone as 16705-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 16705-1-AP (MTH1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16705-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 16705-1-AP (same clone as 16705-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 16705-1-AP (MTH1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16705-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-3 using 16705-1-AP (same clone as 16705-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 16705-1-AP (MTH1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16705-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 16705-1-AP (same clone as 16705-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 16705-1-AP (MTH1 antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16705-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 16705-1-AP (same clone as 16705-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 16705-1-AP (MTH1 antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16705-1-PBS in a different storage buffer formulation.

• 

  IF Staining of PC-3 using 16705-1-AP (same clone as 16705-1-PBS)

  Immunofluorescent analysis of PC-3 cells using 16705-1-AP (MTH1 antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 16705-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

MTH1 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 16705-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

NUDT1, 2-hydroxy-dATP diphosphatase, 7,8-dihydro-8-oxoguanine triphosphatase, 8 oxo dGTPase, 8-oxo-dGTPase

---

Product Information

16705-1-PBS targets MTH1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10103

  Product name: Recombinant human NUDT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-179 aa of BC014618

  Sequence: MSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV

• Full Name: nudix (nucleoside diphosphate linked moiety X)-type motif 1
• Calculated Molecular Weight: 179aa,20 kDa; 197aa,23 kDa
• Observed Molecular Weight: 18-24 kDa
• GenBank Accession Number: BC014618
• Gene Symbol: MTH1
• Gene ID (NCBI): 4521
• RRID: AB_2153822
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P36639
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MTH1, also known as NUDT1 or 8-Oxo-dGTPase, is an important repair enzyme that prevents oxidative stress-induced DNA damage through hydrolyzing mutagenic 8-oxo-dGTP into 8-oxo-dGMP. MTH1 is expressed in postmitotic neurons as well as in proliferative tissues, and it is localized both in the mitochondria and nucleus. MTH1 might be a useful marker of oxidative stress and its level increased upon oxidative stress. Increased expression of MTH1 were also found in various cancer tissues and neurodegenerative diseases.