MTHFD1L Monoclonal antibody, PBS Only (Capture)

MTHFD1L Monoclonal Antibody for WB, IHC, FC (Intra), Cytometric bead array, Indirect ELISA
Cat No. 68321-1-PBS
Clone No.1G1F2

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat, rabbit

Applications

WB, IHC, FC (Intra), Cytometric bead array, Indirect ELISA

1G1F2, EC:6.3.4.3, FTHFSDC1, Monofunctional C1-tetrahydrofolate synthase, mitochondrial, MTC1THFS

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68321-1-PBS targets MTHFD1L as part of a matched antibody pair:

MP50271-2: 68321-1-PBS capture and 68321-3-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat, rabbit
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag9061

Product name: Recombinant human MTHFD1L protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 427-775 aa of BC017477

Sequence: GRMVVASDKSGQPVTADDLGVTGALTVLMKDAIKPNLMQTLEGTPVFVHAGPFANIAHGNSSVLADKIALKLVGEEGFVVTEAGFGADIGMEKFFNIKCRASGLVPNVVVLVATVRALKMHGGGPSVTAGVPLKKEYTEENIQLVADGCCNLQKQIQITQLFGVPVVVALNVFKTDTRAEIDLVCELAKRAGAFDAVPCYHWSVGGKGSVDLARAVREAASKRSRFQFLYDVQVPIVDKIRTIAQAVYGAKDIELSPEAQAKIDRYTQQGFGNLPICMAKTHLSLSHQPDKKGVPRDFILPISDVRASIGAGFIYPLVGTMSTMPGLPTRPCFYDIDLDTETEQVKGLF

Predict reactive species
Full Name methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like
Calculated Molecular Weight 978 aa, 106 kDa
Observed Molecular Weight106 kDa
GenBank Accession NumberBC017477
Gene Symbol MTHFD1L
Gene ID (NCBI) 25902
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ6UB35
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

MTHFD1L(Monofunctional C1-tetrahydrofolate synthase, mitochondrial) is also named as FTHFSDC1(Formyltetrahydrofolate synthetase). MTHFD1L enzyme is present in mitochondria from normal embryonic tissues and embryonic fibroblast cell lines, and embryonic mitochondria possess the ability to synthesize formate from glycine. It catalyzes the final step in the mitochondrial conversion of 1-C units to formate in embryos. Moreover, MTHFD1L levels were substantially higher in embryonic mitochondria than in adult liver mitochondria and embryonic mitochondria exhibited greater formate production(PMID:19948730). It has 2 isoforms produced by alternative splicing.

Loading...
||
New chat Able
正在加载,请稍候...