• Featured Product
  • KD/KO Validated

MTHFD1L Monoclonal antibody

MTHFD1L Monoclonal Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 68321-1-Ig
Clone No.1G1F2

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat, rabbit

Applications

WB, IHC, FC (Intra), ELISA

1G1F2, EC:6.3.4.3, FTHFSDC1, Monofunctional C1-tetrahydrofolate synthase, mitochondrial, MTC1THFS

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inU2OS cells, HEK-293 cells, rabbit testis tissue, rat testis tissue, LNCaP cells, HeLa cells, HepG2 cells
Positive IHC detected inmouse liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68321-1-Ig targets MTHFD1L in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, rabbit samples.

Tested Reactivity human, mouse, rat, rabbit
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag9061

Product name: Recombinant human MTHFD1L protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 427-775 aa of BC017477

Sequence: GRMVVASDKSGQPVTADDLGVTGALTVLMKDAIKPNLMQTLEGTPVFVHAGPFANIAHGNSSVLADKIALKLVGEEGFVVTEAGFGADIGMEKFFNIKCRASGLVPNVVVLVATVRALKMHGGGPSVTAGVPLKKEYTEENIQLVADGCCNLQKQIQITQLFGVPVVVALNVFKTDTRAEIDLVCELAKRAGAFDAVPCYHWSVGGKGSVDLARAVREAASKRSRFQFLYDVQVPIVDKIRTIAQAVYGAKDIELSPEAQAKIDRYTQQGFGNLPICMAKTHLSLSHQPDKKGVPRDFILPISDVRASIGAGFIYPLVGTMSTMPGLPTRPCFYDIDLDTETEQVKGLF

Predict reactive species
Full Name methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like
Calculated Molecular Weight 978 aa, 106 kDa
Observed Molecular Weight106 kDa
GenBank Accession NumberBC017477
Gene Symbol MTHFD1L
Gene ID (NCBI) 25902
RRIDAB_2935394
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ6UB35
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MTHFD1L(Monofunctional C1-tetrahydrofolate synthase, mitochondrial) is also named as FTHFSDC1(Formyltetrahydrofolate synthetase). MTHFD1L enzyme is present in mitochondria from normal embryonic tissues and embryonic fibroblast cell lines, and embryonic mitochondria possess the ability to synthesize formate from glycine. It catalyzes the final step in the mitochondrial conversion of 1-C units to formate in embryos. Moreover, MTHFD1L levels were substantially higher in embryonic mitochondria than in adult liver mitochondria and embryonic mitochondria exhibited greater formate production(PMID:19948730). It has 2 isoforms produced by alternative splicing.

Protocols

Product Specific Protocols
FC protocol for MTHFD1L antibody 68321-1-IgDownload protocol
IHC protocol for MTHFD1L antibody 68321-1-IgDownload protocol
WB protocol for MTHFD1L antibody 68321-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...