CoraLite®594-conjugated MYBPC3 Monoclonal antibody

• 

  WB analysis using CL594-67608

  Various lysates were subjected to SDS PAGE followed by western blot with CL594-67608 (MYBPC3 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

MYBPC3 Monoclonal Antibody for WB

Cat No. CL594-67608

Clone No.3C8F8

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat, pig

Applications

WB

Synonyms

Cardiac MyBP C, CMH4, DKFZp779E1762, FHC, MYBP C, MYBPC3

---

Tested Applications

• Positive WB detected in: rat heart tissue, mouse heart tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-67608 targets MYBPC3 in WB applications and shows reactivity with Human, mouse, rat, pig samples.

• Tested Reactivity: Human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15848

  Product name: Recombinant human MYBPC3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-328 aa of BC151211

  Sequence: MPEPGKKPVSAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSYAVIAGSSKVKFDLKVIEAEKAEPMLAPAPAPAEATGAPGEAPAPAAELGESAPSPKGSSSAALNGPTPGAPDDPIGLFVMRPQDGEVTVGGSITFSARVAGASLLKPPVVKWFKGKWVDLSSKVGQHLQLHDSYDRASKVYLFELHITDAQPAFTGSYRCEVSTKDKFDCSNFNLTVHEAMGTGDLDLLSAFRRTSLAGGGRRISDSHEDTGILDFSSLLKKRDSFRTPRDSKLEAPAEEDVWEILRQA

• Full Name: myosin binding protein C, cardiac
• Calculated Molecular Weight: 1274 aa, 141 kDa
• Observed Molecular Weight: 140-150 kDa
• GenBank Accession Number: BC151211
• Gene Symbol: MYBPC3
• Gene ID (NCBI): 4607
• RRID: AB_3673521
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q14896
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

MYBPC3 belongs to the immunoglobulin superfamily and MyBP family. MYBPC3 located in the crossbridge region of vertebrate striated muscle a bands. In vitro it binds MHC, F-actin and native thin filaments, and modifies the activity of actin-activated myosin ATPase. It may modulate muscle contraction or may play a more structural role. Defects in MYBPC3 are the cause of cardiomyopathy familial hypertrophic type 4 (CMH4).