MYEOV Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MYEOV Polyclonal antibody, PBS Only (11151-1-PBS)

• 

  WB analysis of SGC-7901 using 11151-1-AP (same clone as 11151-1-PBS)

  SGC-7901 cells were subjected to SDS PAGE followed by western blot with 11151-1-AP (MYEOV antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11151-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 11151-1-AP (same clone as 11151-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 11151-1-AP (MYEOV Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11151-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 11151-1-AP (same clone as 11151-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 11151-1-AP (MYEOV antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11151-1-PBS in a different storage buffer formulation.

MYEOV Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 11151-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

11151-1-PBS targets MYEOV in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1498

  Product name: Recombinant human MYEOV protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-313 aa of BC011815

  Sequence: MALRICVTYTPALPIGLCTRCCLCLEQSPSWCHCLRGVSFLTFHLHQSVPLGDRDSLLMFTRQAGHFVEGSKAGRSRGRLCLSQALRVAVRGAFVSLWFAAGAGDRERNKGDKGAQTGAGLSQEAEDVDVSRARRVTDAPQGTLCGTGNRNSGSQSARAVGVAHLGEAFRVGVEQAISSCPEEVHGRHGLSMEIMWARMDVALRSPGRGLLAGAGALCVTLAESSCPDYERGRRACLTLHRHPTPHCSTWGLPLRVAGSWLTVVTVEALGGWRMGVRRTGQVGPTMHPPPVSGASPLLLHHLLLLLLIIILTC

• Full Name: myeloma overexpressed (in a subset of t(11;14) positive multiple myelomas)
• Calculated Molecular Weight: 33 kDa
• Observed Molecular Weight: 55-60 kDa
• GenBank Accession Number: BC011815
• Gene Symbol: MYEOV
• Gene ID (NCBI): 26579
• RRID: AB_671520
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96EZ4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MYEOV, also named as OCIM, was originally isolated by the application of the NIH/3T3 tumorigenicity assay with DNA from a gastric carcinoma. It is a prognostic factor for patients with multiple myeloma, in part through a role of MYEOV in the control of MMC proliferation. MYEOV is a candidate oncogene activated in the amplification core located proximal toCCND1. The observed MW of this protein is 55 kDa(PMID: 20854874 ).