Myosin Light Chain 2/MLC-2V Monoclonal antibody

Myosin Light Chain 2/MLC-2V Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 60229-1-Ig
Clone No.5A1F1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IHC, IF/ICC, ELISA

MLC 2v, MYL2, MLC-2s/v, MLC-2, MLC2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman heart tissue, pig heart tissue, rat heart tissue, rabbit heart tissue
Positive IHC detected inmouse heart tissue, human heart tissue, mouse skeletal muscle tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inC2C12 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60229-1-Ig targets Myosin Light Chain 2/MLC-2V in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

Tested Reactivity human, mouse, rat, pig, rabbit
Cited Reactivityhuman, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag1356

Product name: Recombinant human MYL2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-166 aa of BC015821

Sequence: MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD

Predict reactive species
Full Name myosin, light chain 2, regulatory, cardiac, slow
Calculated Molecular Weight 19 kDa
Observed Molecular Weight 18 kDa
GenBank Accession NumberBC015821
Gene Symbol Myosin Light Chain 2
Gene ID (NCBI) 4633
RRIDAB_2881356
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP10916
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MYL2, also named as MLC-2v and MLC-2, is ventricular/cardiac muscle isoform. Defects in MYL2 are the cause of cardiomyopathy familial hypertrophic type 10 (CMH10). Defects in MYL2 are the cause of cardiomyopathy familial hypertrophic with mid-left ventricular chamber type 2 (MVC2). MYL2 has been widely used as a marker of mature ventricular cardiomyocytes.

Protocols

Product Specific Protocols
IF protocol for Myosin Light Chain 2/MLC-2V antibody 60229-1-IgDownload protocol
IHC protocol for Myosin Light Chain 2/MLC-2V antibody 60229-1-IgDownload protocol
WB protocol for Myosin Light Chain 2/MLC-2V antibody 60229-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Stem Cells

Nitric Oxide-cGMP-PKG Pathway Acts on Orai1 to Inhibit the Hypertrophy of Human Embryonic Stem Cell-Derived Cardiomyocytes.

Authors - Y Wang
humanIF

World J Stem Cells

MiR-21-5p-enriched exosomes from hiPSC-derived cardiomyocytes exhibit superior cardiac repair efficacy compared to hiPSC-derived exosomes in a murine MI model

Authors - Jing-Jun Jin
ratWB

Int J Stem Cells

Synergistic Effect of Hydrogen and 5-Aza on Myogenic Differentiation through the p38 MAPK Signaling Pathway in Adipose-Derived Mesenchymal Stem Cells

Authors - Jingcheng Wang
humanIF

Stem Cell Rev Rep

MYOCD is Required for Cardiomyocyte-like Cells Induction from Human Urine Cells and Fibroblasts Through Remodeling Chromatin.

Authors - Xiangyu Zhang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Irem (Verified Customer) (04-19-2022)

Unfortunately, this antibody unspecifically binds to many proteins in Jurkat cells.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:800
  • Cell Tissue Type: Jurkat cells
Myosin Light Chain 2/MLC-2V Antibody Western Blot validation (1:800 dilution) in Jurkat cells (Cat no:60229-1-Ig)
Loading...
||
New chat Able
正在加载,请稍候...