CoraLite® Plus 488-conjugated MYL4 Monoclonal antibody

• 

  IF Staining of mouse heart using CL488-67533

  Immunofluorescent analysis of (4% PFA) fixed mouse heart tissue using CoraLite® Plus 488 MYL4 antibody (CL488-67533, Clone: 2F5C1 ) at dilution of 1:100.

• Featured Product
• KD/KO Validated

MYL4 Monoclonal Antibody for IF-P

Cat No. CL488-67533

Clone No.2F5C1

Host / Isotype

Mouse / IgG2b

Reactivity

Human, mouse, rat, pig

Applications

IF-P

Synonyms

ALC1, AMLC, GT1, MLC1, MYL4, Myosin light chain 4, PRO1957

---

Tested Applications

• Positive IF-P detected in: mouse heart tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67533 targets MYL4 in IF-P applications and shows reactivity with Human, mouse, rat, pig samples.

• Tested Reactivity: Human, mouse, rat, pig
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19244

  Product name: Recombinant human MYL4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-197 aa of BC030228

  Sequence: MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFDPKSVKIDFTADQIEEFKEAFSLFDRTPTGEMKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNVKMLDFETFLPILQHISRNKEQGTYEDFVEGLRVFDKESNGTVMGAELRHVLATLGEKMTEAEVEQLLAGQEDANGCINYEAFVKHIMSG

• Full Name: myosin, light chain 4, alkali; atrial, embryonic
• Calculated Molecular Weight: 197 aa, 22 kDa
• Observed Molecular Weight: 22-25 kDa
• GenBank Accession Number: BC030228
• Gene Symbol: MYL4
• Gene ID (NCBI): 4635
• RRID: AB_2919493
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P12829
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Myosin light‐chain 4 (MYL4) encodes an essential myosin light chain that is expressed in embryonic whole heart and skeletal muscle. It is specifically expressed in human atria after birth. MYL4 is essential for atrial electrical, functional, and structural integrity, and MYL4 dysfunction can produce severe inherited atrial cardiomyopathy.