MYL6 Monoclonal antibody, PBS Only

• 

  WB analysis using 68142-1-Ig (same clone as 68142-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68142-1-Ig (MYL6 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68142-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 68142-1-Ig (same clone as 68142-1-PBS)

  WB result of MYL6 antibody (68142-1-Ig; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-MYL6 transfected A549 cells. This data was developed using the same antibody clone with 68142-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 68142-1-Ig (same clone as 68142-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 68142-1-Ig (MYL6 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68142-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 68142-1-Ig (same clone as 68142-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 68142-1-Ig (MYL6 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68142-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 68142-1-Ig (same clone as 68142-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 68142-1-Ig (MYL6 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68142-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 68142-1-Ig (same clone as 68142-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 68142-1-Ig (MYL6 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68142-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat heart using 68142-1-Ig (same clone as 68142-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 68142-1-Ig (MYL6 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68142-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 68142-1-Ig (same clone as 68142-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 68142-1-Ig (MYL6 antibody) at dilution of 1:2000 (under 4x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68142-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat skeletal muscle using 68142-1-Ig (same clone as 68142-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat skeletal muscle tissue slide using 68142-1-Ig (MYL6 antibody) at dilution of 1:2000 (under 4x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68142-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 68142-1-Ig (same clone as 68142-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using MYL6 antibody (68142-1-Ig, Clone: 2G4C9 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 68142-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

MYL6 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 68142-1-PBS

Clone No.2G4C9

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat, pig, rabbit

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

17 kDa myosin light chain, ESMLC, LC17, LC17 GI, LC17 NM, LC17A, LC17B, MLC 3, MLC1SM, MLC3NM, MLC3SM, MYL6, Myosin light chain 3, Myosin light chain A3, Myosin light chain alkali 3, Myosin light polypeptide 6

---

Product Information

68142-1-PBS targets MYL6 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with Human, mouse, rat, pig, rabbit samples.

• Tested Reactivity: Human, mouse, rat, pig, rabbit
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13091

  Product name: Recombinant human MYL6 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-151 aa of BC006781

  Sequence: MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCINYEAFVRHILSG

• Full Name: myosin, light chain 6, alkali, smooth muscle and non-muscle
• Calculated Molecular Weight: 17 kDa
• Observed Molecular Weight: 17-25 kDa
• GenBank Accession Number: BC006781
• Gene Symbol: MYL6
• Gene ID (NCBI): 4637
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P60660
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. MYL6 (Myosin light polypeptide 6), encodes a myosin alkali light chain that is expressed in smooth muscle and non-muscle tissues. Expression of MYL6 is high in fibroblasts and myoblasts (PMID:8188229, PubMed:2304459, PMID:2722814).