MYL6 Monoclonal antibody, PBS Only (Capture)

Name: MYL6 Monoclonal antibody, PBS Only (Capture), 100ug
Brand: Proteintech
SKU: 68142-1-PBS-100UG

MYL6 Monoclonal Antibody for WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

Cat No. 68142-1-PBS

Clone No.2G4C9

Review Product

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

2G4C9, MLC-3, MYL 6

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHCIF/ICCCytometric bead array sample testCytometric bead array

WB analysis using 68142-1-Ig (same clone as 68142-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 68142-1-Ig (MYL6 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68142-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of A549 using 68142-1-Ig (same clone as 68142-1-PBS)
WB result of MYL6 antibody (68142-1-Ig; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-MYL6 transfected A549 cells. This data was developed using the same antibody clone with 68142-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon using 68142-1-Ig (same clone as 68142-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 68142-1-Ig (MYL6 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68142-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon using 68142-1-Ig (same clone as 68142-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 68142-1-Ig (MYL6 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68142-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human kidney using 68142-1-Ig (same clone as 68142-1-PBS)
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 68142-1-Ig (MYL6 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68142-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse heart using 68142-1-Ig (same clone as 68142-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 68142-1-Ig (MYL6 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68142-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat heart using 68142-1-Ig (same clone as 68142-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 68142-1-Ig (MYL6 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68142-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse skeletal muscle using 68142-1-Ig (same clone as 68142-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 68142-1-Ig (MYL6 antibody) at dilution of 1:2000 (under 4x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68142-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat skeletal muscle using 68142-1-Ig (same clone as 68142-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat skeletal muscle tissue slide using 68142-1-Ig (MYL6 antibody) at dilution of 1:2000 (under 4x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68142-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HeLa using 68142-1-Ig (same clone as 68142-1-PBS)
Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using MYL6 antibody (68142-1-Ig, Clone: 2G4C9 ) at dilution of 1:1000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 68142-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Cytometric bead array sample test of MP51759-1
Cytometric bead array sample test of MP51759-1, MYL6 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 68142-1-PBS. Detection antibody: 68142-2-PBS.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Cytometric bead array standard curve of MP51759-1
Cytometric bead array standard curve of MP51759-1, MYL6 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 68142-1-PBS. Detection antibody: 68142-2-PBS. Standard:Ag13091. Range: 0.781-100 ng/mL.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

68142-1-PBS targets MYL6 as part of a matched antibody pair:

MP51759-1: 68142-1-PBS capture and 68142-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity	human, mouse, rat, pig, rabbit
Host / Isotype	Mouse / IgG1
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag13091 Product name: Recombinant human MYL6 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-151 aa of BC006781 Sequence: MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCINYEAFVRHILSG Predict reactive species
Full Name	myosin, light chain 6, alkali, smooth muscle and non-muscle
Calculated Molecular Weight	17 kDa
Observed Molecular Weight	17-25 kDa
GenBank Accession Number	BC006781
Gene Symbol	MYL6
Gene ID (NCBI)	4637
RRID	AB_2935258
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein G purification
UNIPROT ID	P60660
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. MYL6 (Myosin light polypeptide 6), encodes a myosin alkali light chain that is expressed in smooth muscle and non-muscle tissues. Expression of MYL6 is high in fibroblasts and myoblasts (PMID:8188229, PubMed:2304459, PMID:2722814).