• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated MYL6 Monoclonal antibody

MYL6 Monoclonal Antibody for IF/ICC
Cat No. CL488-68142
Clone No.2G4C9

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat, pig, rabbit

Applications

IF/ICC

17 kDa myosin light chain, ESMLC, LC17, LC17 GI, LC17 NM, LC17A, LC17B, MLC 3, MLC1SM, MLC3NM, MLC3SM, MYL6, Myosin light chain 3, Myosin light chain A3, Myosin light chain alkali 3, Myosin light polypeptide 6

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-68142 targets MYL6 in IF/ICC applications and shows reactivity with Human, mouse, rat, pig, rabbit samples.

Tested Reactivity Human, mouse, rat, pig, rabbit
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag13091

Product name: Recombinant human MYL6 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-151 aa of BC006781

Sequence: MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCINYEAFVRHILSG

Predict reactive species
Full Name myosin, light chain 6, alkali, smooth muscle and non-muscle
Calculated Molecular Weight 17 kDa
Observed Molecular Weight17-25 kDa
GenBank Accession NumberBC006781
Gene Symbol MYL6
Gene ID (NCBI) 4637
RRIDAB_3084415
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP60660
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. MYL6 (Myosin light polypeptide 6), encodes a myosin alkali light chain that is expressed in smooth muscle and non-muscle tissues. Expression of MYL6 is high in fibroblasts and myoblasts (PMID:8188229, 2304459, 2722814).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 MYL6 antibody CL488-68142Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...