CoraLite® Plus 750-conjugated MYL7 Recombinant monoclonal antibody

MYL7 Uni-rAb® Recombinant Antibody for WB, FC (Intra)
Cat No. CL750-81570
Clone No.2C5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, FC (Intra)

2C5, MLC2a, MLC-2a, MYL2A, MYL7/MLC2a

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 750
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inrat heart tissue, mouse heart tissue
Positive FC (Intra) detected inC2C12 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL750-81570 targets MYL7 in WB, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag11058

Product name: Recombinant human MYL7 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-175 aa of BC027915

Sequence: MASRKAGTRGKVAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKADLRETYSQLGKVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGKGVVNKDEFKQLLLTQADKFSPAEVEQMFALTPMDLAGNIDYKSLCYIITHGDEKEE

Predict reactive species
Full Name myosin, light chain 7, regulatory
Calculated Molecular Weight 175 aa, 19 kDa
Observed Molecular Weight19 kDa
GenBank Accession NumberBC027915
Gene Symbol MYL7
Gene ID (NCBI) 58498
RRIDAB_3673731
Conjugate CoraLite® Plus 750 Fluorescent Dye
Excitation/Emission Maxima Wavelengths755 nm / 780 nm
Excitation LaserRed Laser (633 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ01449
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

MYL7, also known as myosin light chain 2a (MLC2a), is essential for heart development. The expression of MYL7 in heart is predominatantly restricted to the atrium. So its expression has been considered as useful marker for atrial cardiomyocytes.

Protocols

Product Specific Protocols
FC protocol for CL Plus 750 MYL7 antibody CL750-81570Download protocol
WB protocol for CL Plus 750 MYL7 antibody CL750-81570Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...